Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_011883666.1 RpiR family transcriptional regulator
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_000016205.1:WP_011883666.1 Length = 642 Score = 266 bits (681), Expect = 8e-76 Identities = 143/316 (45%), Positives = 190/316 (60%), Gaps = 4/316 (1%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKV-EVKDGCIAIA 64 L+ DVGGTNAR AL + GEI+Q + Y G DYP+L IR YL++ K+ V IAIA Sbjct: 21 LLADVGGTNARFAL-ETGPGEITQIRVYPGADYPTLTDAIRKYLKDVKIARVNHAAIAIA 79 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 P+ GD V MTNH W+FSI ++ LGF L ++NDFTA++MA+P L +Q GG Sbjct: 80 NPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTR 139 Query: 125 VEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHV 184 + I + G GTGLGV+ L+ D RW++L EGGH FAP E E ++L+ R + HV Sbjct: 140 RQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAPQDEREDLVLQYARKKFPHV 199 Query: 185 SAERVLSGPGLVNLYRAIVKAD-NRLPENLKPKDITERALADSCTDCRRALSLFCVIMGR 243 S ERV +GPG+ +YRA+ D R+ ++ DI ERA A + FC I+G Sbjct: 200 SFERVCAGPGIEIIYRALAARDKKRVAASVDTADIVERAHAGEAL-ALETVECFCGILGS 258 Query: 244 FGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDN 303 F G++AL LG GGV+I GG+ + E F S FRA FE KGRF Y+ +IP YLI + Sbjct: 259 FAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKGRFAHYLQNIPTYLITAEY 318 Query: 304 PGLLGSGAHLRQTLGH 319 P LG A L + L + Sbjct: 319 PAFLGVSAILAEQLSN 334 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 642 Length adjustment: 33 Effective length of query: 288 Effective length of database: 609 Effective search space: 175392 Effective search space used: 175392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
Align candidate WP_011883666.1 (RpiR family transcriptional regulator)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.7026.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-101 323.3 0.0 1.3e-100 322.7 0.0 1.2 1 lcl|NCBI__GCF_000016205.1:WP_011883666.1 RpiR family transcriptional regu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016205.1:WP_011883666.1 RpiR family transcriptional regulator # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 322.7 0.0 1.3e-100 1.3e-100 1 313 [. 21 323 .. 21 325 .. 0.96 Alignments for each domain: == domain 1 score: 322.7 bits; conditional E-value: 1.3e-100 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiigdf 69 l++d+GGtnar+al e pgei q+++y + d+p l++++r yl++ k+ + ++++aia P+ gd lcl|NCBI__GCF_000016205.1:WP_011883666.1 21 LLADVGGTNARFAL-ETGPGEITQIRVYPGADYPTLTDAIRKYLKDVKIARVN--HAAIAIANPVDGDQ 86 79************.*********************************98888..8************* PP TIGR00749 70 vrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtGlG 138 v +tn+dW++sie +++ l++ l ++ndf+a a+a+++l + + +q+gg +++ i +lG+GtGlG lcl|NCBI__GCF_000016205.1:WP_011883666.1 87 VTMTNHDWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLG 155 ********************************************************************* PP TIGR00749 139 vatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrkge 207 v+ li+ +d+r+ +l +eGgh++faP++e e l+l+y+rkk+ +vs erv +G+G+ +iy+al r+ lcl|NCBI__GCF_000016205.1:WP_011883666.1 156 VSGLIP-ADDRWIALGSEGGHASFAPQDEREDLVLQYARKKFPHVSFERVCAGPGIEIIYRALAARDK- 222 ******.9*********************************************************993. PP TIGR00749 208 revsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfiel 276 k + di e+a +g+ +la +++e f++ilG++ag +al+lga GGvy+ GG++ ++ el lcl|NCBI__GCF_000016205.1:WP_011883666.1 223 ----KRVAASVDTADIVERAHAGE-ALALETVECFCGILGSFAGSVALTLGALGGVYIGGGVALKLGEL 286 ....33336667899*****9997.57889*************************************** PP TIGR00749 277 lkkssfraafedkGrlkellasiPvqvvlkkkvGllG 313 + +ssfra+fe kGr+ ++l++iP +++ + + +lG lcl|NCBI__GCF_000016205.1:WP_011883666.1 287 FTRSSFRARFEAKGRFAHYLQNIPTYLITAEYPAFLG 323 ****************************999998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (642 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 19.03 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory