Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_011911355.1 PST_RS00545 long-chain fatty acid--CoA ligase
Query= BRENDA::D3GE78 (556 letters) >NCBI__GCF_000013785.1:WP_011911355.1 Length = 539 Score = 192 bits (488), Expect = 3e-53 Identities = 157/515 (30%), Positives = 239/515 (46%), Gaps = 36/515 (6%) Query: 46 LTTHDLRLWSQRLAAGLRK-SGLQRGDRVLLFSGNDLFFPVVFLGVIMAGGIFTGANPTF 104 L+ DL + A LR +GLQ GDR+ L N L +P+ G + AG + NP + Sbjct: 45 LSYADLARQADAFARYLRHHAGLQPGDRLALQLPNSLQYPIATFGALKAGLVIVNTNPQY 104 Query: 105 VARELAYQLQDSGATYLLCASNSLETGLEAAKQAKLPQSHIFAYDTSIYDGVTNPQKGCA 164 A E +Q +DSGA +L L L A QA I TS+ D + Sbjct: 105 TAAEARHQFRDSGARAILVLDRLLP--LVRAVQADTALERIIL--TSVED-----LQAPV 155 Query: 165 YWSDLLASEEEGAAFTWDELSTPALSSTT-----LALNYSSGTTGRPKGVEISHRNYVAN 219 Y S A+E A E S PAL L Y+ GTTG KG +SHRN +AN Sbjct: 156 YDSLEPATERFMQALRLGEQS-PALDCVVGLERLALLQYTGGTTGVSKGAMLSHRNLLAN 214 Query: 220 MLQ----YCHTASLHPDYKARLERSRWLCFLPMYHAMA--QNIFIAAALYRATPVYIMSK 273 +LQ + L P+ R+ LP+YH MA N + + T V+I Sbjct: 215 VLQTIELFDKPGLLEPEKDVRIAP------LPLYHIMAFATNCLSSVGMGLHT-VFIRDG 267 Query: 274 FDFVKMLEYTQRFRITDFILVPPVVVALAKHPAVGQYDLSSVELVGSGAAPLGREVCEEV 333 + + + QR + + + V L HP D S ++ SG APL EV Sbjct: 268 RNLDETIGAMQRHPFSLLSGINTLFVGLMNHPQFRSIDFSHLKWATSGGAPLNSEVGRRW 327 Query: 334 EKLWPPGKINIKQGWGMTEATCSVTGWNPAEISTSASVGELNANCEAKIMFDGVEVKERN 393 + L I++G+G+TEA+ V +G+ + E + + D Sbjct: 328 QVLTGAP---IREGFGLTEASPVVATGTALSPYREGYIGQALIDTELRTVDDDGNDVPAE 384 Query: 394 SRGELWVRAPNVMKGYWRNEKATKETKTEDGWLLTGDIAFVDDDGKFHVVDRMKELIKVK 453 S GELW+R P VM+GYW+ + T + T DGWL TGDIA +D +G +VDR K++I V Sbjct: 385 SPGELWLRGPQVMQGYWQRPEETAKVITADGWLKTGDIALLDAEGFVKIVDRKKDMILVS 444 Query: 454 GNQVAPAELEALLLEHPAISDVAVIGVV-INNDERPRAYVVLRPGQSATANEIAHYLDNK 512 G V P E+E +L++HP++ + +G+ E + +V LR ++ + + Sbjct: 445 GFNVFPNEIEDVLMQHPSVRECVAVGIPDARKGEAVKVFVSLR--EATDDQALLEHCRQF 502 Query: 513 VSAFKRITGGVVFLEAIPKNPSGKILRMKLREQAK 547 ++ +K + + + +PK GK+LR +LR++A+ Sbjct: 503 LTGYK-LPSAIEIRDELPKTAVGKLLRRQLRDEAR 536 Lambda K H 0.319 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 621 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 556 Length of database: 539 Length adjustment: 36 Effective length of query: 520 Effective length of database: 503 Effective search space: 261560 Effective search space used: 261560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory