Align Acetate kinase; EC 2.7.2.1; Acetokinase (uncharacterized)
to candidate WP_011911909.1 PST_RS03550 acetate/propionate family kinase
Query= curated2:Q1QPW6 (404 letters) >NCBI__GCF_000013785.1:WP_011911909.1 Length = 402 Score = 373 bits (958), Expect = e-108 Identities = 194/389 (49%), Positives = 266/389 (68%), Gaps = 4/389 (1%) Query: 4 ILVVNAGSSSVKFQVFSAE-GEGKLLRQIKGQVDGIGSRPRLRASGADNEPLADRAYPIE 62 I+ VNAGSSS+K +FS GE + +G++DGIG PRL+ AD + D ++ E Sbjct: 9 IVTVNAGSSSIKTGLFSGRRGEDQPRLLARGKLDGIGVAPRLQVVMADGTIMQDTSFEPE 68 Query: 63 SVSDVPAAMGVAGGWLRDELRISP-MAVGHRVVHGGPDYDRPVLIDHGVVARLERFVALA 121 ++++ AA L + L+ P + +GHRVVHGG D+ PV +DH +ARL+ LA Sbjct: 69 QIANMQAAFQQIYRVLEEGLQDRPPVLIGHRVVHGGMDFSAPVRVDHTTLARLKTLEPLA 128 Query: 122 PLHQPNNLDPIRSLLANFPALPQVACFDTAFHRTHDAVADYYAIPYQFYVEGVRRYGFHG 181 PLHQP+NL I + L + P LPQ+ACFDTAFH + ++ + +PY Y +GVRRYGFHG Sbjct: 129 PLHQPHNLAAIHAALEHDPQLPQIACFDTAFHAGRNEISQLFGLPYALYEQGVRRYGFHG 188 Query: 182 LSYEYVAKTLPHVAPEIAKGRVIVAHLGSGASMCALKGGRSIESTMGFTALDGLPMGTRP 241 LS+EYV++ L PE+A G++++AHLG+G+S+CA++ GRSIE T GF+ALDGLPMG+R Sbjct: 189 LSFEYVSQRLIDKTPELATGKLVIAHLGNGSSLCAIEAGRSIEMTTGFSALDGLPMGSRC 248 Query: 242 GQIDPGVVLYLVSEKGMSPAKAQDFLYRDCGLKGLSGVSNDMRELEASEDPKAKLAVDYF 301 G +DPGV+LYL+ + G+S + + LYR GL G+SGVS+DMR+L AS +P+A LA+DY+ Sbjct: 249 GAVDPGVLLYLLGQ-GISVDELEKLLYRQSGLLGISGVSSDMRKLRASNEPRAALAIDYY 307 Query: 302 VYRVGLNAGMLAAALQGLDAFVFTAGIGENSMRIRARIADQLAWL-GVTLDPTQNSRHAR 360 YR+ G LA L GLDA VFTAGIGE +RA++ LA L G+ LD N R+A Sbjct: 308 AYRIAQEVGRLATCLGGLDALVFTAGIGEKDAELRAQVLQHLAPLFGLQLDDAANRRNAE 367 Query: 361 LISGSDSRIPVYVIPTDEELMIAQHTLSL 389 LISG+ S V+VIPTDEE +IA+H L Sbjct: 368 LISGTSSTRSVWVIPTDEESIIARHAWKL 396 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 402 Length adjustment: 31 Effective length of query: 373 Effective length of database: 371 Effective search space: 138383 Effective search space used: 138383 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_011911909.1 PST_RS03550 (acetate/propionate family kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.24113.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-105 339.2 0.0 1.7e-105 339.0 0.0 1.0 1 lcl|NCBI__GCF_000013785.1:WP_011911909.1 PST_RS03550 acetate/propionate f Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013785.1:WP_011911909.1 PST_RS03550 acetate/propionate family kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 339.0 0.0 1.7e-105 1.7e-105 3 404 .. 6 397 .. 4 398 .. 0.91 Alignments for each domain: == domain 1 score: 339.0 bits; conditional E-value: 1.7e-105 TIGR00016 3 skkilvlnaGssslkfalldaensekv...llsglverikleeariktvedg...ekkeeeklaiedhe 65 +++i+ +naGsss+k l+ + +e l++g + i ++ ++ dg ++++ e +i++ + lcl|NCBI__GCF_000013785.1:WP_011911909.1 6 DELIVTVNAGSSSIKTGLFSGRRGEDQprlLARGKLDGIGVAPRLQVVMADGtimQDTSFEPEQIANMQ 74 678999**************99887766669**********9986655555522245566778899999 PP TIGR00016 66 eavkkllntlkkdkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegi 134 +a +++ + l++ l++ liGHRvvhGg +f+ v v++ +l+++k + +lAPlH p +l +i lcl|NCBI__GCF_000013785.1:WP_011911909.1 75 AAFQQIYRVLEE--G-LQDRP-PVLIGHRVVHGGMDFSAPVRVDHTTLARLKTLEPLAPLHQPHNLAAI 139 999999999995..2.34444.459******************************************** PP TIGR00016 135 eavlklkvllkaknvavFDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkp 203 +a+l + ++ +++a+FDtafH +e + l++lPy ly+ +gvRrYGfHG+s++yv+qr+ ++ lcl|NCBI__GCF_000013785.1:WP_011911909.1 140 HAAL--EHDPQLPQIACFDTAFHAGRNEISQLFGLPYALYE-QGVRRYGFHGLSFEYVSQRLIDKTPE- 204 ***9..8899999*************************996.69*****************9999877. PP TIGR00016 204 lddlnlivcHlGnGasvsavknGksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieet 272 l+ +l+++HlGnG+s++a++ G+si+ + G+ L+Gl mG+R+G +Dp+++ yl +g s+de+e++ lcl|NCBI__GCF_000013785.1:WP_011911909.1 205 LATGKLVIAHLGNGSSLCAIEAGRSIEMTTGFSALDGLPMGSRCGAVDPGVLLYLLG-QGISVDELEKL 272 9999***************************************************86.69********* PP TIGR00016 273 lnkksGllgisglssDlRdildkkeegneeaklAlkvyvhRiakyigkyiaslegelDaivFtgGiGen 341 l ++sGllgisg+ssD+R++ + + +a+lA++ y++Ria+ +g+ ++ l g lDa+vFt+GiGe lcl|NCBI__GCF_000013785.1:WP_011911909.1 273 LYRQSGLLGISGVSSDMRKLRASN---EPRAALAIDYYAYRIAQEVGRLATCLGG-LDALVFTAGIGEK 337 *******************98877...778***********************66.************* PP TIGR00016 342 aaevrelvlekle.vlGlkldlelnnaarsgkesvisteeskvkvlviptneelviaeDalrla 404 +ae+r++vl++l+ ++Gl+ld + n + +is + s+ v vipt+ee++ia+ a++l lcl|NCBI__GCF_000013785.1:WP_011911909.1 338 DAELRAQVLQHLApLFGLQLDDAANR----RNAELISGTSSTRSVWVIPTDEESIIARHAWKLY 397 ************8467*****99998....67789**************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (402 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.19 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory