Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_011911948.1 PST_RS03755 polyamine ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000013785.1:WP_011911948.1 Length = 369 Score = 237 bits (605), Expect = 3e-67 Identities = 133/325 (40%), Positives = 195/325 (60%), Gaps = 28/325 (8%) Query: 4 ITLRNVQKRF-GEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMI 62 ++ R VQK + GE++++ L+LDI GEF+ +GPSG GK+T L ++AG E + G+I++ Sbjct: 11 VSFRGVQKSYDGESLIVRDLNLDIRRGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEILL 70 Query: 63 DGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKILN 122 +GR +PP KR + MVFQ+YAL+PHMTV +N+AFPL + M +I+ RV A ++ Sbjct: 71 NGRAINNVPPHKRDMGMVFQNYALFPHMTVSENLAFPLSVRGMAKPDIKERVKRALAMVQ 130 Query: 123 LTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELHQS 182 L + +R P QLSGGQ+QRVA+ RA+V EP L DEPL LD LR M++EI LH+ Sbjct: 131 LEGFRNRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREQMQMEIKHLHER 190 Query: 183 LETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIG------- 235 L T++YVTHDQ EA+TM+D++ V + G+I+Q+ P TLY P N FVA F+G Sbjct: 191 LGVTVVYVTHDQGEALTMSDRVAVFHQGQIQQIEDPRTLYEKPLNTFVANFLGENNRLPA 250 Query: 236 ----------SPKMNLIEGPE--AAKHGAT----TIGIRPEHIDLSREAGA----WEGEV 275 + K+ E E A GAT ++ IRPE + L+ + + + G V Sbjct: 251 HLLERRGESCTVKLGRGETVEALAVNVGATGSPVSLSIRPERVLLNGASASCPNRFTGRV 310 Query: 276 GVSEHLGSDTFLHVHVAGMPTLTVR 300 +LG + + V G+ V+ Sbjct: 311 AEFIYLGDHIRIRLEVCGVSDFFVK 335 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 369 Length adjustment: 29 Effective length of query: 303 Effective length of database: 340 Effective search space: 103020 Effective search space used: 103020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory