Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2 (characterized, see rationale)
to candidate WP_011912438.1 PST_RS06395 3-carboxy-cis,cis-muconate cycloisomerase
Query= uniprot:A0A0C4YE08 (470 letters) >NCBI__GCF_000013785.1:WP_011912438.1 Length = 453 Score = 455 bits (1171), Expect = e-132 Identities = 242/446 (54%), Positives = 300/446 (67%), Gaps = 4/446 (0%) Query: 4 SSRLTDPMFGSAATLAAFSDTATVQRMLDFEAALARAEASCGVIPADAAEAIAATCRAGE 63 S++L D F SA FSD VQ MLDFEAALARAEA GVIPA A +AI A C A Sbjct: 5 SNQLFDVYFTSAPMREVFSDRGRVQGMLDFEAALARAEARTGVIPATAVDAIEAACHAEH 64 Query: 64 IDFDALAAAAVAGGNLAIPLVRQLTARVAARDAQAARYVHWGATSQDAIDTGMVLQLREA 123 D ALA A GN AIPLV+ L +VAA D A +YVH GATSQDA+D+G+VLQLR+A Sbjct: 65 YDLCALAEAVATAGNSAIPLVKALGRQVAANDPDAEKYVHLGATSQDAMDSGLVLQLRQA 124 Query: 124 LQAVDADLKALGHACAALAAQHRDTPMVARTWLQHALPTTFGLKAAGWLDALRRDLRRLD 183 L ++ DL+ LG A A AA+H +TPM RTWLQHA P T G+K AGWL A+ R +RL Sbjct: 125 LALLETDLRRLGDALADQAARHAETPMAGRTWLQHATPVTLGMKIAGWLGAVTRHRQRLA 184 Query: 184 AARAQAATLQFGGAAGTLASLGAAAPAVATALGSALSLAVAPTPWHAYRDRMVEVATTLG 243 R + LQFGGA+G+LA+LG A V+ AL L L + PWH RDR+VE A+ LG Sbjct: 185 ELRPRLLCLQFGGASGSLAALGEQAWPVSEALAGELGLNLPDQPWHTQRDRLVEFASLLG 244 Query: 244 MLTGSLGKIARDVSLMMQTEVAEVAEPTGPGRGGSSTMPHKRNPVGCAAVLTAAVRVPPL 303 ++ GSLGK+ RD++L+MQT+V EV EP PG+GGSSTMPHKRNPVGCA ++ AA R P L Sbjct: 245 LIAGSLGKLGRDLALLMQTDVGEVFEPAAPGKGGSSTMPHKRNPVGCAVMIAAATRAPGL 304 Query: 304 VATMLAGMVQEHERALGGWQAEWDTLPQIVTLAAGALRQMLEVVGGLQVDAARMRANLGV 363 VATML+ + QEHER+LG W AEW+TLP++ L +GAL Q L V L+VD R+R NL + Sbjct: 305 VATMLSALPQEHERSLGLWLAEWETLPELCCLVSGALSQALIAVPALEVDGERLRGNLEL 364 Query: 364 THGLILAEAAMLELGGKIGRLPAHHLVEGACRRAVAEGTTLRQALGATLAEDAAHAGLMD 423 T GL+LAEA + L +GR AH LVE C++AVAEG LR L + + + Sbjct: 365 TRGLVLAEAVSIALAQLVGREKAHELVEQCCKQAVAEGRHLR----GVLRDSPEVSSRFN 420 Query: 424 AAALDRVCDPANYAGQAAGFVDAVLA 449 A LDR+ DPANY GQA +V+ +A Sbjct: 421 DAELDRLLDPANYLGQARRWVERAVA 446 Lambda K H 0.319 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 453 Length adjustment: 33 Effective length of query: 437 Effective length of database: 420 Effective search space: 183540 Effective search space used: 183540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_011912438.1 PST_RS06395 (3-carboxy-cis,cis-muconate cycloisomerase)
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02426.hmm # target sequence database: /tmp/gapView.27701.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02426 [M=338] Accession: TIGR02426 Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-144 464.7 11.0 9.5e-144 464.4 11.0 1.1 1 lcl|NCBI__GCF_000013785.1:WP_011912438.1 PST_RS06395 3-carboxy-cis,cis-mu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013785.1:WP_011912438.1 PST_RS06395 3-carboxy-cis,cis-muconate cycloisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.4 11.0 9.5e-144 9.5e-144 1 333 [. 8 346 .. 8 351 .. 0.98 Alignments for each domain: == domain 1 score: 464.4 bits; conditional E-value: 9.5e-144 TIGR02426 1 lldglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaaelalDlealaeaaae 69 l+d +f+ ++e+fsdr+r+++mld+Eaalara+a++G+ipa a++ai+aa+++ ++Dl alaea+a+ lcl|NCBI__GCF_000013785.1:WP_011912438.1 8 LFDVYFTSAPMREVFSDRGRVQGMLDFEAALARAEARTGVIPATAVDAIEAACHAEHYDLCALAEAVAT 76 6788999999*********************************************************** PP TIGR02426 70 agnvviplvkalrkavae...eaaryvHlGaTSQDviDTalmLqlrdaldllladlerlaeaLaelaar 135 agn++iplvkal ++va+ +a++yvHlGaTSQD +D +l+Lqlr+al+ll+ dl+rl +aLa++aar lcl|NCBI__GCF_000013785.1:WP_011912438.1 77 AGNSAIPLVKALGRQVAAndpDAEKYVHLGATSQDAMDSGLVLQLRQALALLETDLRRLGDALADQAAR 145 *****************99999*********************************************** PP TIGR02426 136 hrdtpltarTllQqAvpttvglkaagwlaavlrardrlealrtealalqfGGAaGtlaalekkglavae 204 h++tp+ +rT+lQ+A+p+t+g+k+agwl av+r+r+rl++lr ++l lqfGGA+G+laal++++ v e lcl|NCBI__GCF_000013785.1:WP_011912438.1 146 HAETPMAGRTWLQHATPVTLGMKIAGWLGAVTRHRQRLAELRPRLLCLQFGGASGSLAALGEQAWPVSE 214 ********************************************************************* PP TIGR02426 205 alAaelgLeapalpWhtqrdriaelaaaLalvagalgkiaqDvallaqtevgevle.agg..GGSSamp 270 alA+elgL++p +pWhtqrdr++e+a++L+l+ag+lgk+++D+all+qt+vgev+e a++ GGSS+mp lcl|NCBI__GCF_000013785.1:WP_011912438.1 215 ALAGELGLNLPDQPWHTQRDRLVEFASLLGLIAGSLGKLGRDLALLMQTDVGEVFEpAAPgkGGSSTMP 283 ********************************************************877689******* PP TIGR02426 271 HKrNPvaaevlaaaarrapglvatLfaalaqedeRsaggWhaeWetLrelvaltagalrqaae 333 HKrNPv+++v++aaa+rapglvat+++al+qe+eRs+g W aeWetL+el++l++gal+qa lcl|NCBI__GCF_000013785.1:WP_011912438.1 284 HKRNPVGCAVMIAAATRAPGLVATMLSALPQEHERSLGLWLAEWETLPELCCLVSGALSQALI 346 ***********************************************************9865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (338 nodes) Target sequences: 1 (453 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.72 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory