Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_011913279.1 PST_RS10855 glutathione-dependent formaldehyde dehydrogenase
Query= BRENDA::P22144 (363 letters) >NCBI__GCF_000013785.1:WP_011913279.1 Length = 417 Score = 116 bits (291), Expect = 1e-30 Identities = 90/288 (31%), Positives = 136/288 (47%), Gaps = 24/288 (8%) Query: 6 SLVLNKIDDISFETYDAPEISEPTDVLVQVKKTGICGSDIHFYAHGRIGNFVLTKPMVLG 65 ++V + + DI FE P I PTD +V++ + ICG+D+HF G + + +LG Sbjct: 3 AVVYHAVGDIRFEDVPEPRILAPTDAIVRITASAICGTDLHF-VRGTVSG--MQPGTILG 59 Query: 66 HESAGTVVQVGKGVTSLKVGDNVAIEPGIPSRFSDEYKSGHYNLCPHMAFAATPNSKE-- 123 HE G V +G V +L++GD V I I ++G++ C A PN KE Sbjct: 60 HEGVGIVEALGADVRNLQIGDRVVIPSTIACGNCSYCRAGYFAQCD----GANPNGKEAG 115 Query: 124 ----GEPNPPGTL--CKYFKSPEDF----LVKLPDHVSLELGALVEPL-SVGVHASKLGS 172 G P G + K+ F LVKLP +S + L+ + G +++ Sbjct: 116 TSFYGGPQTTGPFHGLQAEKARIPFANIGLVKLPPEISDDQAILLSDIFPTGYFGAEMAE 175 Query: 173 VAFGDYVAVFGAGPVGLLAAAVAKTFGAKGVIVVDIFDNKLKMAKDIGAATHTFNSKTGG 232 V GD VAVFG GPVG A A AK GA V +D D++L+MA+ GA F+ + Sbjct: 176 VGSGDTVAVFGCGPVGQFAIASAKLLGAGRVFAIDRHDDRLRMAQRQGAEAINFD-REDP 234 Query: 233 SEELIKAFGGNVPNVVLECTGAEP---CIKLGVDAIAPGGRFVQVGNA 277 E L + GG + V++ G + C + + G+ Q G+A Sbjct: 235 VETLKRLTGGIGVDRVIDAVGVDAEHGCCGAAATSSSAQGQLWQPGDA 282 Lambda K H 0.318 0.138 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 417 Length adjustment: 30 Effective length of query: 333 Effective length of database: 387 Effective search space: 128871 Effective search space used: 128871 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory