Align Glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_011914522.1 PST_RS17435 glucokinase
Query= reanno::WCS417:GFF4431 (318 letters) >NCBI__GCF_000013785.1:WP_011914522.1 Length = 322 Score = 412 bits (1059), Expect = e-120 Identities = 201/318 (63%), Positives = 237/318 (74%) Query: 1 MKLALVGDIGGTNARFALWRDQELHSIRVHATADHSSPEDAIKVYLKEEGLEIGDIGAVC 60 M+LALVGDIGGTNARFALWR+ L ++RV ATAD ++PE A++ YL GL G +GA C Sbjct: 1 MRLALVGDIGGTNARFALWRNARLEAVRVLATADFATPELAVEYYLASLGLAPGSVGAAC 60 Query: 61 LSVAGPVSGDEFKFTNNHWRLSKTAFCKTLQVDELLLVNDFSAMALGMTRLKPDEFRVVC 120 L+ AGPV G++F FTNNHWRL + FC LQ+DELLL+NDF+AMALGMTR+ + R++C Sbjct: 61 LACAGPVKGEQFVFTNNHWRLGRRDFCGALQLDELLLINDFAAMALGMTRVAEAQRRIIC 120 Query: 121 EGTPEPLRPAVVIGPGTGLGVGTLLDLGAGRFAALPGEGGHVDLPLSSPRETQLWQHIYT 180 G E PA+VIGPGTGLGV TLL L G + ALPGEGGHVDLPL+ E LWQ ++ Sbjct: 121 NGVAETGAPALVIGPGTGLGVATLLPLAGGGWQALPGEGGHVDLPLADAYEAALWQQLFA 180 Query: 181 EIGHVSAETALSGGGLPRLYRAICAVDGHTPVLETPEAITAAGLAGDPVAMEVLDQFSIW 240 +GHV AE LSGGGL LYRA+C + P L +P +TAA LAGD +A L+QF +W Sbjct: 181 GLGHVRAEDVLSGGGLLLLYRALCLLHDQAPRLASPAEVTAAALAGDTLAAATLEQFCVW 240 Query: 241 LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFINSGFAKSFADKGCMSDYFKGIPVWLVT 300 LGRVAGNNVLT G R GVYIVGGV+PRFADFF SGFA+ FA KGCMS Y +PVWLVT Sbjct: 241 LGRVAGNNVLTLGARAGVYIVGGVVPRFADFFAASGFARGFASKGCMSAYLADVPVWLVT 300 Query: 301 APYSGLTGAGVALEQAFA 318 A Y GL GAGVALEQA A Sbjct: 301 AEYPGLEGAGVALEQALA 318 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 322 Length adjustment: 28 Effective length of query: 290 Effective length of database: 294 Effective search space: 85260 Effective search space used: 85260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_011914522.1 PST_RS17435 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.1553.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-79 252.9 0.1 2.6e-79 252.7 0.1 1.0 1 lcl|NCBI__GCF_000013785.1:WP_011914522.1 PST_RS17435 glucokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013785.1:WP_011914522.1 PST_RS17435 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 252.7 0.1 2.6e-79 2.6e-79 1 315 [] 5 310 .. 5 310 .. 0.96 Alignments for each domain: == domain 1 score: 252.7 bits; conditional E-value: 2.6e-79 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiigdf 69 lvgdiGGtnar+al ++e+v+++ + df e +v +yl + +c+a a+P+ g+ lcl|NCBI__GCF_000013785.1:WP_011914522.1 5 LVGDIGGTNARFAL--WRNARLEAVRVLATADFATPELAVEYYLASLGLAPGSVGAACLACAGPVKGEQ 71 89************..67778999*********************99999988679************* PP TIGR00749 70 vrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtGlG 138 +tn++W l + l l +l lindfaa+a++++ + e + + +e++a+ ++G+GtGlG lcl|NCBI__GCF_000013785.1:WP_011914522.1 72 FVFTNNHWRLGRRDFCGALQLDELLLINDFAAMALGMTRVAEAQRRIICNGVAETGAPALVIGPGTGLG 140 ******************************************99999999999**************** PP TIGR00749 139 vatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrkge 207 vatl++ + g +++l+geGghvd+ + e+ l++ l + +g+v ae vlsG Gl l+y+al + lcl|NCBI__GCF_000013785.1:WP_011914522.1 141 VATLLPLAGGGWQALPGEGGHVDLPLADAYEAALWQQLFAGLGHVRAEDVLSGGGLLLLYRALCLLH-- 207 ***************************************************************9887.. PP TIGR00749 208 revsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfiel 276 ++ +l + +++ aal+g+ +la +le f++ lG++agn l+lgar Gvy++GG+vPrf ++ lcl|NCBI__GCF_000013785.1:WP_011914522.1 208 DQAPRLA----SPAEVTAAALAGD-TLAAATLEQFCVWLGRVAGNNVLTLGARAGVYIVGGVVPRFADF 271 5678888....89*********97.67889*************************************** PP TIGR00749 277 lkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 + +s+f +f kG + ++la++Pv +v + +Gl Gag lcl|NCBI__GCF_000013785.1:WP_011914522.1 272 FAASGFARGFASKGCMSAYLADVPVWLVTAEYPGLEGAG 310 *************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (322 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.04 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory