Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_011914902.1 PST_RS19390 SDR family oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000013785.1:WP_011914902.1 Length = 255 Score = 98.2 bits (243), Expect = 1e-25 Identities = 79/256 (30%), Positives = 125/256 (48%), Gaps = 24/256 (9%) Query: 12 VAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEA----QAKKLGNNCVFAPADVTS 67 VA++TG G+G A RL +GA V+ N Q + LG F ADV Sbjct: 7 VALVTGSTQGIGRGIAVRLAEEGADIVINGRENDEQARESLEQVRALGRRVCFIAADVGD 66 Query: 68 EKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFN 127 + + + + G++D+ VN AG+ + + + +D+ +VL+VNL G F Sbjct: 67 VEQCHRLVRESIAQMGQLDILVNNAGVQRHAAFLDAQA------DDYDQVLNVNLRGPFF 120 Query: 128 VIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLA 187 + + A + + G+ G IIN +SV AY ASKGG+ + IA +LA Sbjct: 121 LAQAFARHLREQ-----GRGGRIINNSSVHEELPHPNFTAYCASKGGLKMLMRNIAIELA 175 Query: 188 PIGIRVMTIAPGLFGTPL---LTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENP 244 P+GI V +APG TP+ L + P+K+ N L +P RLG P + A +V A + +P Sbjct: 176 PLGITVNNVAPGAVETPINRELMNQPDKLANLL-QNIP-AGRLGRPHDVAGVV-AFLASP 232 Query: 245 ---FLNGEVIRLDGAI 257 ++ G + +DG + Sbjct: 233 DAEYITGTTLVVDGGL 248 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory