Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_011936959.1 GURA_RS00060 DUF4162 domain-containing protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_000016745.1:WP_011936959.1 Length = 308 Score = 110 bits (275), Expect = 3e-29 Identities = 77/235 (32%), Positives = 121/235 (51%), Gaps = 8/235 (3%) Query: 3 KVMLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRI 62 K +S ++ YG +A+ + SL + QG I L+G NGAGKTTL+ L R TSG Sbjct: 2 KTAVSLKTITKAYGAFRAVEDFSLDVEQGIIFALLGPNGAGKTTLIKILTTLMRPTSGDA 61 Query: 63 VFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFF--AERDQFQERIKWV 120 + + + K +R + +VP+ + +T ENL + ++ I + Sbjct: 62 FVEGHSVLT--SGKQVRLLIGVVPQENNLDRYLTARENLVLHARMHGMPPHEYNPTIDRL 119 Query: 121 YELFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTI 180 EL L RR T SGG Q+ L + RAL+ NP++L LDEP+ GL P + ++D I Sbjct: 120 MELIG-LFGRRNDFPDTFSGGMQRRLVVARALVHNPQVLFLDEPTTGLDPQSRRALWDYI 178 Query: 181 EQLREQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYL 235 + LR + MTIFL ++A L DR ++++G ++ T L EA+ A++ Sbjct: 179 QSLRSR-MTIFLTTHYMDEADALCDRIMIMDHGKALVDGTASQL--KEALSHAHI 230 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 308 Length adjustment: 25 Effective length of query: 212 Effective length of database: 283 Effective search space: 59996 Effective search space used: 59996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory