Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate WP_011937796.1 GURA_RS04390 alanine--glyoxylate aminotransferase family protein
Query= metacyc::MONOMER-15919 (385 letters) >NCBI__GCF_000016745.1:WP_011937796.1 Length = 357 Score = 224 bits (572), Expect = 2e-63 Identities = 133/343 (38%), Positives = 189/343 (55%), Gaps = 11/343 (3%) Query: 6 VKKLLMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVFITENDTFLITGS 65 + K L IPGP V PE+L AMA P+IGHR +Y+ L + +KLK++ T FL T S Sbjct: 1 MSKKLFIPGPIEVAPEILEAMATPMIGHRMPEYARLHKGVTDKLKELLFTREKVFLATSS 60 Query: 66 GTAAMDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVKE 125 M+ A+ N++ G + N G F +++ ++ + EA + VEWG+ PE V Sbjct: 61 AFGVMEGAVRNLV--GKRCANFCNGAFSDKWHDVTRRCGKEADAIKVEWGEPITPELVDA 118 Query: 126 IL--DKYDDIKAVTVVHNETSTGARNPIKEIGEVVKDY-DALYIVDTVSSLGGDYVNVDK 182 L KYD A+T++HNETSTG +P+ EI V++ Y D + I+DTVSS+ + +D+ Sbjct: 119 TLASGKYD---AITLIHNETSTGVMSPLPEIAAVLRKYPDVVSIIDTVSSMSAVKIPLDE 175 Query: 183 FHIDICVTGSQKCLAAPPGLAAITVSEKAWEVIKKNDDKVGFYLDLLAYKKYYEEKKQTP 242 ID C+ G QK A PPGLA T S KA E K + + G+Y D L + +EK TP Sbjct: 176 LGIDCCIFGVQKAFALPPGLAVFTASNKALERCKTIEGR-GYYFDFLEFAA-ADEKDNTP 233 Query: 243 YTPSVNLTYALNVALDLVLEEGIENRVKRHERLAKATRAGLEAMGIELFAKERARSVTVT 302 TP ++L YAL+ L+ + EG E R +RH LA+ R + G A E RS+T+T Sbjct: 234 STPCISLIYALDRQLERIFAEGFEKRWQRHRELAEYVRGWVSERGFGFLAAEPYRSLTLT 293 Query: 303 SAKYPEGIEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMG 345 A I+ ++ + L + N G L GK FRI HMG Sbjct: 294 CAVNSRDIDLAELKKRLGER-NYAFDNGYGKLKGKTFRIAHMG 335 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 357 Length adjustment: 30 Effective length of query: 355 Effective length of database: 327 Effective search space: 116085 Effective search space used: 116085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory