Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_011939814.1 GURA_RS15130 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000016745.1:WP_011939814.1 Length = 246 Score = 134 bits (337), Expect = 2e-36 Identities = 77/233 (33%), Positives = 124/233 (53%), Gaps = 2/233 (0%) Query: 4 LKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFL 63 L L + V V +V+ GEV+ L+G NGAGKTT + GL RP SG + Sbjct: 10 LYTRELKKSFNRRMVVNSVDLKVSSGEVIGLLGPNGAGKTTTFYMVVGLCRPDSGAVYLD 69 Query: 64 GQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENL-EMGAFLKKNREENQANLKKVFSR 122 G I +P G+S +P+ VF LTV ENL + +K +R + ++++ + Sbjct: 70 GDAITDLPMYLRARKGISYLPQEPSVFRKLTVEENLMAVLETMKLSRSRCRERVEELLAE 129 Query: 123 FPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDI 182 F R+ LSGGE++ + + RAL + P +LLDEP G+ P+ + +I II D+ Sbjct: 130 F-RITHIARSKGFALSGGERRRVEIARALATDPAFILLDEPFAGIDPLAVIDIQGIITDL 188 Query: 183 QKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 + +G VL+ + N + L + D+ Y+L G+++ G ++A S + R+ YLG Sbjct: 189 KNKGLGVLISDHNVRETLGVCDKAYILNAGEVLEFGDPVQIAESRKAREIYLG 241 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 246 Length adjustment: 23 Effective length of query: 213 Effective length of database: 223 Effective search space: 47499 Effective search space used: 47499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory