Align Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) (characterized)
to candidate WP_011939882.1 GURA_RS15490 acetyl-CoA C-acyltransferase
Query= reanno::Marino:GFF2751 (415 letters) >NCBI__GCF_000016745.1:WP_011939882.1 Length = 391 Score = 285 bits (730), Expect = 1e-81 Identities = 170/406 (41%), Positives = 237/406 (58%), Gaps = 16/406 (3%) Query: 7 LKDAYIVDAIRTPIGRYGGALSAVRADDLGAIPIKALAERYPDLDWSKIDDVLYGCANQA 66 +KD ++V+++RTP G +GG LS V A L A I A ER LD + + +V+ G Sbjct: 1 MKDVFVVESLRTPFGSFGGVLSDVEAPKLAATVIGAALER-TGLDPAAVSEVILGQVLSG 59 Query: 67 GEDNRDVARMSLLLAGLPVDVPGSTINRLCGSGMDAVGSAARAIRTGETQLMIAGGVESM 126 G AR ++ LAG+P V TIN++CGSG+ ++ A +I G++ L++AGG+E+M Sbjct: 60 GAGQAP-ARQAMRLAGIPDGVHAMTINKVCGSGLKSIMLGAGSIMLGDSNLVVAGGMENM 118 Query: 127 SRAPFVMGKADSAFSR-KAEIFDTTIGWRFVNPVLKKQYGIDSMPETAENVAADFGISRE 185 S PF++ KA + E+ D I +P K G + AE A G SRE Sbjct: 119 SLTPFILKKARYGYRMGHGELLDLMIYDGLQDPYSGKHMG-----DIAEAAVAKHGFSRE 173 Query: 186 DQDAFALRSQQRTAAAQKEGRLAAEITPVTIPRRKQDPLVVDTDEHPRETSLEKLASLPT 245 +QD FA+RS + A K G EI PV +K D +V D DE P + KL L Sbjct: 174 EQDEFAVRSYRLAQEAVKGGVFKDEIVPVVKNGKKGDEVVAD-DEDPFKVDFAKLTQLRP 232 Query: 246 PFRENGTVTAGNASGVNDGACALLLAGADALKQYNLKPRARVVAMATAGVEPRIMGFGPA 305 F+++G +TAGNAS ++DGA LLA ALK++NLKPRAR+VA AT + P + P Sbjct: 233 AFKKDGAITAGNASSISDGAAVTLLADEGALKKHNLKPRARLVAYATYSMHPELYTDAPV 292 Query: 306 PATRKVLATAGLELADMDVIELNEAFAAQALAVTRDLGLPDDAEHVNPNGGAIALGHPLG 365 A + A AGL++AD+D+ E+NEAFAA + + LGL D VN NGGA A+GHP+G Sbjct: 293 GAIQAACARAGLKVADIDLFEINEAFAAVTMIAIKQLGL--DPAKVNVNGGACAIGHPIG 350 Query: 366 MSGARLVTTALNELERRHAAGQKARYALCTMCIGVGQGIALIIERM 411 SGARL T + EL RR ++RY L T+CIG G+ +A+I ER+ Sbjct: 351 ASGARLAATVIRELHRR-----QSRYGLATLCIGGGEAVAVIFERV 391 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 415 Length of database: 391 Length adjustment: 31 Effective length of query: 384 Effective length of database: 360 Effective search space: 138240 Effective search space used: 138240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory