Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_011951605.1 SWIT_RS03865 2,3-dehydroadipyl-CoA hydratase
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000016765.1:WP_011951605.1 Length = 259 Score = 231 bits (588), Expect = 1e-65 Identities = 130/256 (50%), Positives = 165/256 (64%) Query: 2 PHTLSVDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSRKAF 61 P TL V+ GV LI L PE NAL T LL +A E+ AE D + R VV+TGS F Sbjct: 4 PRTLIVERRAGGVVLIRLNHPERRNALATPLLRAVADEINAAEGDKDVRVVVITGSDTLF 63 Query: 62 AAGADIKEMAERDLVGILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIA 121 AAGADI E+ +E PR W I +FSKPL+AAV G+CLG G EL M ADI++A Sbjct: 64 AAGADIDELLASGAGDPIETPRYIAWAAIRSFSKPLVAAVEGWCLGAGAELMMCADIVVA 123 Query: 122 GEDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTL 181 + A+ GQPE NLGI+PGAGGT L R +G++ AM MVL+G+ I A A GLV+ + Sbjct: 124 AKGAKIGQPETNLGIIPGAGGTATLPRRIGQARAMHMVLTGEPIGAEEAHAIGLVACLAE 183 Query: 182 PELTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAE 241 ++ ALA+A +A +APLA+R AK ++ AE D A+ LR ER F L GTAD+AE Sbjct: 184 QGQALDDALALAAKLAMRAPLALRAAKASIRDAEHLDEAAHLRSERVRFLKLLGTADKAE 243 Query: 242 GIRAFQEKRRPEFTGR 257 GI AF+EKRRP++ GR Sbjct: 244 GITAFREKRRPDWQGR 259 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 259 Length adjustment: 24 Effective length of query: 233 Effective length of database: 235 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory