Align 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) (EC 1.2.4.4) (characterized)
to candidate WP_011951628.1 SWIT_RS03980 alpha-ketoacid dehydrogenase subunit beta
Query= reanno::Smeli:SMc03202 (337 letters) >NCBI__GCF_000016765.1:WP_011951628.1 Length = 337 Score = 498 bits (1283), Expect = e-146 Identities = 231/336 (68%), Positives = 275/336 (81%) Query: 1 MARMTMIEAVRSAMDVSMARDDNVVVFGEDVGYFGGVFRCTQGLQAKYGKTRCFDTPISE 60 MA+M MI+A+ SA+DV + D NV++FGEDVGYFGGVFR T GLQ K+G TRCFD PISE Sbjct: 1 MAQMNMIQALNSALDVMLGNDPNVLIFGEDVGYFGGVFRVTDGLQKKHGLTRCFDAPISE 60 Query: 61 SGIVGTAIGMAAYGLKPCVEIQFADYMYPAYDQLTQEAARIRYRSNGDFTCPIVVRMPTG 120 GI+ TAIGM AYGL+P EIQFADY+ PAYDQL EAAR+RYRS G+F+ PI VR P G Sbjct: 61 GGIIATAIGMGAYGLRPVPEIQFADYILPAYDQLVSEAARLRYRSGGEFSAPITVRSPYG 120 Query: 121 GGIFGGQTHSQSPEALFTHVCGLKVVVPSNPYDAKGLLISAIEDPDPVMFLEPKRLYNGP 180 GGIFGGQTHSQSPEA+F H+ GLK V+PSNP+DAKGLLI++IE DPV+FLEPKRLYNGP Sbjct: 121 GGIFGGQTHSQSPEAVFAHITGLKTVIPSNPHDAKGLLIASIECDDPVIFLEPKRLYNGP 180 Query: 181 FDGHHERPVTAWSKHELGDVPDGHYTIPIGKAEIRRKGSGVTVIAYGTMVHVALAAAEET 240 FDG H+R + W+ H G+VP+GHYT+P+GKA R+G VTVIAYGTMVHVAL A EE+ Sbjct: 181 FDGRHDRQLRTWAGHAAGEVPEGHYTVPLGKAATVREGKDVTVIAYGTMVHVALGAIEES 240 Query: 241 GIDAEVIDLRSLLPLDLETIVQSAKKTGRCVVVHEATLTSGFGAELAALVQEHCFYHLES 300 GIDAE+IDLRS++PLD++ I S ++TGRCV+VHEA+ GFG EL+ALVQE CFY L+S Sbjct: 241 GIDAELIDLRSIVPLDIDAITASVERTGRCVIVHEASRFGGFGGELSALVQERCFYRLKS 300 Query: 301 PVVRLTGWDTPYPHAQEWDYFPGPARVGRALAEAME 336 P+ R+ GWDTPYPHA EWDYF GPAR+ AL AME Sbjct: 301 PIERVAGWDTPYPHAFEWDYFVGPARIAAALDRAME 336 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 337 Length adjustment: 28 Effective length of query: 309 Effective length of database: 309 Effective search space: 95481 Effective search space used: 95481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory