Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_011952068.1 SWIT_RS06245 pyruvate dehydrogenase complex E1 component subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000016765.1:WP_011952068.1 Length = 466 Score = 271 bits (692), Expect = 3e-77 Identities = 144/316 (45%), Positives = 201/316 (63%), Gaps = 3/316 (0%) Query: 8 DAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAIAGVG 67 +A+ AM EEM RD VFV+GE+V + G +K T GL ++FG+ RV+DTP+ E AG+G Sbjct: 147 EALRDAMAEEMRRDGDVFVMGEEVAQYQGAYKVTQGLLDEFGDRRVIDTPITEYGFAGIG 206 Query: 68 IGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGVHGAL 127 GAAM G++PI E +F M A++ II+ AAK Y S CP+V R P G A Sbjct: 207 TGAAMGGLKPIVEFMTFNFAMQAIDHIINSAAKTNYMSGGQMRCPVVFRGPNGAAARVAA 266 Query: 128 YHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGEVP-A 186 HSQ+ +A+ PGL ++ P + DAKGLLKAA+R DPV+F E++ Y EVP Sbjct: 267 QHSQNYAPWYASVPGLIVISPYSAADAKGLLKAAIRCPDPVVFLENELLYGQ-SFEVPKL 325 Query: 187 DDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLDKEA 246 DDYVLPIGKA + R G D+T+++Y + V AL+AA++LE +GI A V+DLRT+ PLDK Sbjct: 326 DDYVLPIGKARICRTGSDVTIVSYSIGVGVALEAAKQLEGEGIDAEVIDLRTLRPLDKAT 385 Query: 247 IIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYAPTM 306 ++E+ KT ++++V E SI SE+ I E DLDAP++R+ D+P MPYA + Sbjct: 386 VLESLRKTNRMVVVEEGWPVCSIASEIITIAMEEGFDDLDAPVRRVTNQDVP-MPYAANL 444 Query: 307 EKYFMVNPDKVEAAMR 322 EK ++ V AA + Sbjct: 445 EKAALLKVSDVVAAAK 460 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 466 Length adjustment: 30 Effective length of query: 297 Effective length of database: 436 Effective search space: 129492 Effective search space used: 129492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory