Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_011952290.1 SWIT_RS07325 AMP-binding protein
Query= BRENDA::D3GE78 (556 letters) >NCBI__GCF_000016765.1:WP_011952290.1 Length = 596 Score = 168 bits (426), Expect = 5e-46 Identities = 144/522 (27%), Positives = 229/522 (43%), Gaps = 42/522 (8%) Query: 46 LTTHDLRLWSQRLAAGLRKSGLQRGDRVLLFSGNDLFFPVVFLGVIMAGGIFTGANPTFV 105 L+ DL + AAGL GL GDR+ ++S N + + + AG + NP + Sbjct: 46 LSWRDLARRAGDFAAGLLALGLAPGDRIGIWSLNRVEWAITQFAAAKAGLVLVTINPNYR 105 Query: 106 ARELAYQLQDSGATYLLCASNSLETGLEAAKQAKLPQS---------------HIFAYDT 150 EL Y L+ G ++ AS + + +P+ H+ D Sbjct: 106 LSELEYALRSVGCAAVVTASVFKSSDYVGMLRTLMPEMAAGPGFVAERLPALRHVIQMDP 165 Query: 151 SIYDGVTNPQKGCAYWSDLLASEEEGAAFTWDELSTPALSSTTLALNYSSGTTGRPKGVE 210 P G ++ + A + L S + + ++SGTTG PKGV Sbjct: 166 E-------PVAGAVAFATVEALGRDAGPARLRALEGVLGSRDPVNIQFTSGTTGLPKGVT 218 Query: 211 ISHRNYVANMLQYCHTASLHPDYKARLERSRWLCF-LPMYHAMAQNIF-IAAALYRATPV 268 +SHRN + N K +L +C +P+YH + +AA + A V Sbjct: 219 LSHRNILNN--------GYFTGLKLKLTAQDRICIPVPLYHCFGMVMGNLAAVTHGAAMV 270 Query: 269 YIMSKFDFVKMLEYTQRFRITDFILVPPVVVALAKHPAVGQYDLSSVELVGSGAAPLGRE 328 Y FD + L R T VP + +A +HPA +DLSS+ +P E Sbjct: 271 YPGEGFDPLATLAALSGERCTALYGVPTMFIAQLEHPAFAAHDLSSLRTGIMAGSPCPIE 330 Query: 329 VCEEVEKLWPPGKINIKQGWGMTEATC----SVTGWNPAEISTSASVGELNANCEAKIMF 384 V + +I I +GMTE + S T +P E+ +VG ++ + E KI+ Sbjct: 331 VMRKAIDRMNLREITIC--YGMTETSPVSFQSETD-DPVELRVG-TVGRVHPHLEVKIVD 386 Query: 385 DGVEVKERNSRGELWVRAPNVMKGYWRNEKATKETKTEDGWLLTGDIAFVDDDGKFHVVD 444 D E R GEL R +VM GYW + + T + GW+ +GD+A +D+DG +V Sbjct: 387 DAGETVPRGVAGELCTRGYSVMLGYWNDPEQTAAAIDDAGWMHSGDLATIDEDGYCRIVG 446 Query: 445 RMKELIKVKGNQVAPAELEALLLEHPAISDVAVIGVVINN-DERPRAYVVLRPGQSATAN 503 R+K+++ G + P E+E L HPAI DVAV GV + E A+++ G Sbjct: 447 RIKDMVIRGGENLYPREIEEFLHTHPAIRDVAVFGVPDRHYGEELCAWIIRHDGAPIDET 506 Query: 504 EIAHYLDNKVSAFKRITGGVVFLEAIPKNPSGKILRMKLREQ 545 E+ + +S ++I + F++A P +GK+ + +REQ Sbjct: 507 EVRAFCRGHIS-HQKIPRHIRFVDAFPLTVTGKVQKFVMREQ 547 Lambda K H 0.319 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 672 Number of extensions: 41 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 596 Length adjustment: 36 Effective length of query: 520 Effective length of database: 560 Effective search space: 291200 Effective search space used: 291200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory