Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_011952604.1 SWIT_RS08910 acyl-CoA dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_1146 (375 letters) >NCBI__GCF_000016765.1:WP_011952604.1 Length = 380 Score = 254 bits (650), Expect = 2e-72 Identities = 138/371 (37%), Positives = 213/371 (57%), Gaps = 2/371 (0%) Query: 5 EEQTQIRDMARQFAEERLKPFAAEWDREHRFPREAIDEMAELGFFGMLVPEQWGGCDTGY 64 E+ RD R+ E L P ++ E R+ E G V +GG + Sbjct: 12 EDHALFRDSVRKMLERELLPNLDRFEEEGIVSRQFWLACGEAGMLCPNVSPDYGGLGLDF 71 Query: 65 LAYAMTLEEIAAGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGAFALT 124 A+ EE+A + + + N + + +G++EQK ++L + SG + A A+T Sbjct: 72 GYNAVIDEELAYAGSSAG--VPLQNDITAEYVQSYGSEEQKRRYLPKMVSGECISAIAMT 129 Query: 125 EPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFIV 184 EP GSD +++T AR GD YV+NG K ++T+GQNA VVIV A TDP G RG+S +V Sbjct: 130 EPATGSDLQAIRTTARRVGDRYVINGAKTYVTNGQNADVVIVAAKTDPGLGARGLSLILV 189 Query: 185 PTDSPGYSVARVEDKLGQHASDTCQILFEDLKVPVGNRLGEEGEGYKIALANLEGGRVGI 244 D+PG++ R DK+G ++DT ++ F D++VPV NRLGEEG G+ ++ L R+ I Sbjct: 190 DADTPGFARGRNLDKIGLWSADTSELFFNDVEVPVANRLGEEGRGFAYLMSQLPQERLSI 249 Query: 245 AAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALR 304 A A A+ AF+ A + ++R++FG+PI E Q F LADM +Q+ V + +A Sbjct: 250 ATSAQAAAQRAFDEALAFVKDRTAFGQPIFEFQNTKFTLADMKSQLQVGWAHLDWAIRRH 309 Query: 305 DSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIYEGTS 364 +G EAS AK + S+M ++ MALQ GG GY+N++ + R++RD RV +I+ GT+ Sbjct: 310 IAGALTTAEASAAKQWHSDMQGRITDMALQLHGGAGYMNEYLIARLWRDARVTRIFGGTN 369 Query: 365 DIQRMVISRNL 375 +I + V+SR+L Sbjct: 370 EIMKEVVSRSL 380 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory