Align L-serine ammonia-lyase (EC 4.3.1.17); D-Serine ammonia-lyase (EC 4.3.1.18) (characterized)
to candidate WP_011989078.1 CKL_RS02495 D-cysteine desulfhydrase family protein
Query= BRENDA::O57809 (325 letters) >NCBI__GCF_000016505.1:WP_011989078.1 Length = 329 Score = 210 bits (534), Expect = 4e-59 Identities = 127/321 (39%), Positives = 183/321 (57%), Gaps = 14/321 (4%) Query: 9 LAKFP-RVELIPWETPIQYLPNISREIGA-DVYIKRDDLTGLGIGGNKIRKLEYLLGDAL 66 + K P R+ + T I+ + +S+++G D+YIKRDD TG I GNKIRKLE+ +AL Sbjct: 1 MIKIPERMNMANLPTKIEKMERLSQKLGGPDIYIKRDDQTGTEISGNKIRKLEFSAAEAL 60 Query: 67 SKGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKE--ELKGNYLLDKIMGIETRV 124 +KG + +IT G + SNH T A KLG LVL G E+ GN LLDK++G E Sbjct: 61 NKGCNTLITCGGIQSNHCRATAAVAVKLGFKCCLVLNGSNDTEVDGNLLLDKLLGAEIYF 120 Query: 125 YDAKD-SFELMKYAEEIAEELKREGRKPYVIPPGGASPIGTLGYVRAVGEIATQS---EV 180 K+ M+ +EI ++ +G KPY+IP G ++ IG GY +AV EI Q +V Sbjct: 121 VSQKEYENRRMEIMKEIKTNMENKGLKPYIIPEGASNGIGGFGYYKAVQEIMLQEREMKV 180 Query: 181 KFDSIVVAAGSGGTLAGLSLGLSILNEDIRPVGIAVGRFGEVMTSKLDNLIKEAAELLGV 240 FD IV+A GSGGT +GL LG ILN D + G+ V + + ++ ++ ++ + + V Sbjct: 181 HFDGIVIATGSGGTYSGLLLGSRILNYDAKIYGVNVCQNEKYFKDRIYEILHDSMKYIDV 240 Query: 241 KVEVRPELYDYSFGEYGK----ITGEVAQIIRKVGTREGIILDPVYTGKAFYGLVDLARK 296 + + + G G+ E + I+++ EGIILDPVYTGKA YGL +K Sbjct: 241 NLNFSKDEINIIDGYVGRGYALSREEELEFIKELAELEGIILDPVYTGKAMYGLTQEIKK 300 Query: 297 GELG--EKILFIHTGGISGTF 315 G+ + +LFIHTGGI G F Sbjct: 301 GKFSKYKNLLFIHTGGIFGIF 321 Lambda K H 0.319 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 329 Length adjustment: 28 Effective length of query: 297 Effective length of database: 301 Effective search space: 89397 Effective search space used: 89397 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory