Align PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM; PTS system EIIA component; Phosphotransferase enzyme IIA component; EC 2.7.1.121 (characterized)
to candidate WP_011989266.1 CKL_RS03430 PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM
Query= SwissProt::Q9CIV6 (123 letters) >NCBI__GCF_000016505.1:WP_011989266.1 Length = 130 Score = 87.0 bits (214), Expect = 8e-23 Identities = 50/125 (40%), Positives = 74/125 (59%), Gaps = 5/125 (4%) Query: 4 GIVIVSHSPEIASGLKKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEE-NEADNLL 62 G+VIVSHS EIA G+K L+ +++ ++ + GG ++G +GT ++ +AIE+ D +L Sbjct: 3 GVVIVSHSSEIARGVKNLVEQISPESNVASAGGTKDGRLGTDACKIKSAIEKVYSEDGVL 62 Query: 63 TFFDLGSARMNLDLVSEMTDK----ELTIFNVPLIEGAYTASALLEAGATFEAIKEQLEK 118 FDLGSA MN ++ E DK ++ I N L+E A A G + E IKE LE Sbjct: 63 ILFDLGSAYMNAEMAIEFLDKSMQSKVQIINGALVESALIAVVDSSIGKSIEEIKEHLEC 122 Query: 119 MLIEK 123 M I+K Sbjct: 123 MCIDK 127 Lambda K H 0.315 0.133 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 56 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 123 Length of database: 130 Length adjustment: 14 Effective length of query: 109 Effective length of database: 116 Effective search space: 12644 Effective search space used: 12644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory