Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_012042026.1 BBTA_RS08325 enoyl-CoA hydratase
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_000015165.1:WP_012042026.1 Length = 261 Score = 177 bits (450), Expect = 2e-49 Identities = 100/254 (39%), Positives = 147/254 (57%), Gaps = 4/254 (1%) Query: 4 NNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFV 63 + V+L+ ++A++T+NRP+ LNAL+ + + ++ IE D+ V A+ILTGAG+++F Sbjct: 3 DTVLLDITDRIALLTLNRPERLNALSYRLIDALMAMLDRIETDAGVRAIILTGAGDRAFS 62 Query: 64 AGADISEMK----EMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSC 119 AGADI E + ++ R F G + RLE KP+IAAVNG A GGGCEI + Sbjct: 63 AGADIHEFAASVGDGRSVALRDFVRRGQAMTSRLEAFPKPIIAAVNGLAFGGGCEITEAV 122 Query: 120 DIRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLV 179 + +AS+ A F + E+ LG+ P FGGTQRL RLVG +L+ T I A A IGLV Sbjct: 123 HLAVASTRASFAKSEIRLGMPPTFGGTQRLPRLVGRKRGLELLLTGDAIPAQRAAEIGLV 182 Query: 180 NKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFST 239 N VV +++ A+E+A +I+ + P AV A RG+ I L E E FG Sbjct: 183 NAVVPHDQMLPAARELAKRIIRHGPEAVTSVITAATRGLNMAIGEGLQVEGEQFGRLVGG 242 Query: 240 EDQKDAMTAFIEKR 253 + + + A+ E+R Sbjct: 243 RELEHGLAAWRERR 256 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 261 Length adjustment: 25 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory