Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_012046884.1 BBTA_RS33135 dicarboxylate--CoA ligase PimA
Query= BRENDA::A7KUK6 (562 letters) >NCBI__GCF_000015165.1:WP_012046884.1 Length = 553 Score = 211 bits (536), Expect = 8e-59 Identities = 158/505 (31%), Positives = 253/505 (50%), Gaps = 40/505 (7%) Query: 69 KGDVLALFTPNSIDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVTQ--AS 126 KG +ALF NS D P+ +G L AG + +P L+ +L +S A+ LVT ++ Sbjct: 71 KGASIALFLGNSPDHPINFFGALKAGARVVHLSPLDGEIALSHKLSDSGARILVTSNLSA 130 Query: 127 VLPVAREAAKKVGMPEDRIILIGDQR------------DPDARVKHFTSVRNISGATRYR 174 +LP+A + +K + DR+I+ D D A + H V GA Sbjct: 131 LLPMALKFLEKGLL--DRLIVCEDDHWGQVGTPQTALPDSPAVITHRAFV---DGAVAPA 185 Query: 175 KQKITPAKDVAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWNGGPDGKGDR 234 D+A L Y+ GTTG+PKG M++H N+ + + I + + G GDR Sbjct: 186 VWPAISPDDIALLQYTGGTTGLPKGAMLTHGNLTSAVSIIEIWSRATRTRSEG----GDR 241 Query: 235 VLAFLPFYHIYGLTCLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCSFSYIVPPVVLLL 294 V+ LP +HIY LT ++ AL G + + +FD+E +++ R ++ VP + + + Sbjct: 242 VICVLPLFHIYALTVVLLTALRIGSLVSLHQRFDLEAVMRDIEHKRATYFPGVPTMWIAI 301 Query: 295 GKHPVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSET-SP-TTHSQRW 352 P +DK DLSSL + SG APL E+ + R+ + +K G+G++ET SP T+H + Sbjct: 302 ANLPDLDKRDLSSLTSVGSGGAPLPVEVARILERRVGMKLKSGWGMTETCSPGTSHPKEG 361 Query: 353 EDWREAMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHENPEAT 412 D GS+G +P ++ +++ + + +G EVGE+ +KGPNV GY PE T Sbjct: 362 PD---KPGSIGIALPGIEMDVVSLED---PTRVLGVNEVGEIRVKGPNVTKGYWNRPEET 415 Query: 413 KGCLSEDGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDAIDDVA 472 D F TGD+GY DA G +++ DR K++I GF V P +E + + A+ +V Sbjct: 416 AQSFVGDR-FLTGDIGYVDADGFYFLVDRKKDMIISGGFNVYPQMIEQAIYIHPAVQEVI 474 Query: 473 VIGIESETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASHKRLRGGVHFVD 532 VIGI G +R + + ++L K+ H+ L V FVD Sbjct: 475 VIGIPDAYRGEAAKAFIKLRDGFAPF-------PVEDLREFLTGKLGKHE-LPAAVEFVD 526 Query: 533 EIPKNPSGKILRRILKQKFKGAAEA 557 E+P+ P GK+ R L+Q+ +++ Sbjct: 527 ELPRTPVGKLSRHELRQQQSSTSQS 551 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 737 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 562 Length of database: 553 Length adjustment: 36 Effective length of query: 526 Effective length of database: 517 Effective search space: 271942 Effective search space used: 271942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory