Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_012048485.1 SWIT_RS11485 alpha-ketoacid dehydrogenase subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000016765.1:WP_012048485.1 Length = 336 Score = 279 bits (713), Expect = 8e-80 Identities = 145/332 (43%), Positives = 215/332 (64%), Gaps = 12/332 (3%) Query: 1 MSVMSYIDAINLAMKEEMERDSRVFVLGEDV----------GRKGGVFKATAGLYEQFGE 50 M++M+ DAI + EMERD + +LGEDV GG++ + GLY +FG Sbjct: 1 MAIMTIRDAILQTLHAEMERDPDIMLLGEDVVGGNGTAGGPEAIGGIWGTSGGLYAKFGP 60 Query: 51 ERVMDTPLAESAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWS 110 ERV+DTP++ESAI G GAA+ G RP+AE+ FADF+ +++QI ++ AK RY Sbjct: 61 ERVIDTPISESAIVGAAAGAALAGKRPVAELMFADFVGVSLDQIWNQIAKFRYMFGGKTR 120 Query: 111 CPIVVRAPYGGGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLF 170 CP V+R YG G++ A HSQSV A+ PGLK+V+P+TP DAKGLL A+R +DPV+F Sbjct: 121 CPAVIRLVYGAGMNTAAQHSQSVYAMLTAMPGLKVVLPATPADAKGLLTEALRGDDPVMF 180 Query: 171 FEHKRAYRLIKGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGIS 230 FEHK Y +KGEVP D+ G+A + REG D T++T G V+F+ +AA++L DGI Sbjct: 181 FEHKTLYG-VKGEVPDGDHRQRFGEARMVREGGDATIVTCGRMVNFSEKAADKLAADGIG 239 Query: 231 AHVVDLRTVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIK 290 V+DLRT PLD+EAI+++ TG++++V E S+ +++ A+++ L AP + Sbjct: 240 CDVIDLRTTSPLDEEAILDSVEATGRLVVVDESPPRCSLAADICALVATKAFSSLKAPPE 299 Query: 291 RLAGPDIPAMPYAPTMEKYFMVNPDKVEAAMR 322 + GP P +P+A +E+ ++ +P K+EAA+R Sbjct: 300 MVTGPHSP-IPFARELERAWVPSPQKIEAAVR 330 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 336 Length adjustment: 28 Effective length of query: 299 Effective length of database: 308 Effective search space: 92092 Effective search space used: 92092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory