GapMind for catabolism of small carbon sources

 

Protein WP_012101416.1 in Clostridium kluyveri DSM 555

Annotation: NCBI__GCF_000016505.1:WP_012101416.1

Length: 276 amino acids

Source: GCF_000016505.1 in NCBI

Candidate for 25 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2560 hi ABC transporter for L-Histidine, ATPase component (characterized) 50% 89% 243.8 CynD, component of Bispecific cyanate/nitrite transporter 44% 228.4
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 40% 60% 169.1 ABC transporter for L-Histidine, ATPase component 50% 243.8
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 40% 60% 169.1 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 55% 164.9 ABC transporter for L-Histidine, ATPase component 50% 243.8
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 55% 164.9 ABC transporter for L-Histidine, ATPase component 50% 243.8
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 87% 162.9 ABC transporter for L-Histidine, ATPase component 50% 243.8
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 87% 162.9 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 42% 55% 156.8 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 37% 58% 156 ABC transporter for L-Histidine, ATPase component 50% 243.8
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 41% 58% 156 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 39% 56% 152.5 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 41% 57% 141.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 32% 81% 99.8 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.7 ABC transporter for L-Histidine, ATPase component 50% 243.8
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 79% 86.7 ABC transporter for L-Histidine, ATPase component 50% 243.8

Sequence Analysis Tools

View WP_012101416.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSKVIEKSRPDNYKIIVKNVQKFYDIKSENGEKSEKFLALDNFNLKIKKGEFITIVGPSG
CGKSTFLDILAGLSKPTSGELYIDDKLIEGPDLDRGIIFQGYALFPWRTVEQNIEFGLEI
KGIPKNERKEISNKFIKLVGLSNFQNRYPHELSGGMKQRVAIARALAYDPDVLLMDEPFA
AVDAQTRELLQEELLNIWEDTNKTIVFITHSIEEAIFLADRVVVMTPNPGKIKEVIEINF
PRPRSTVNVRMSQEFSSNRNRIWELLHGNDDKKHVI

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory