Align L-lactate dehydrogenase (EC 1.1.1.27) (characterized)
to candidate WP_012101770.1 CKL_RS06800 L-lactate dehydrogenase
Query= BRENDA::B9MKZ8 (314 letters) >NCBI__GCF_000016505.1:WP_012101770.1 Length = 315 Score = 346 bits (888), Expect = e-100 Identities = 170/309 (55%), Positives = 236/309 (76%) Query: 6 KIVIIGTGFVGSSTAFALVDAGLATELVLIDVNRAKAEGEAMDLNHGISFVKPVKIWAGD 65 KI I+G GFVGSSTAFA++ +GLA+E+V++D+N+AKAEGE MDL G SFV+P+ I AGD Sbjct: 7 KISIVGAGFVGSSTAFAIMMSGLASEIVIVDINKAKAEGEVMDLVQGESFVEPLSIKAGD 66 Query: 66 YEDCKDADIIIITAGANQKPGETRLDLTYKNAQITKSIIENIIKYTHDAILLMVTNPVDV 125 Y+D KD++I+IITAGA Q G+TRL+L KN I KSII I+KY+ ++ILL+V+NPVDV Sbjct: 67 YKDTKDSNIVIITAGAAQNHGQTRLELIDKNYIIFKSIIPEIVKYSPNSILLIVSNPVDV 126 Query: 126 LTYVMYKVSGLPKNQVIGSGTVLDSSRFRYLLAQHCQVDVRNVHAYILGEHGDSEIAAWS 185 L Y+ YK+SG P ++VIGSGTVLD+SR +Y+++ VD+R+VH Y++GEHGDSEIAAWS Sbjct: 127 LAYMTYKLSGFPSDRVIGSGTVLDTSRLKYIISNELHVDIRDVHGYVMGEHGDSEIAAWS 186 Query: 186 LTNIGGVNFMQECLLCGKNCSPEVKEQIFNKVKNAAYEIIERKGATYYAIALAVRRIVEA 245 L +I G+ + L K+ S E +E+I N V+NAAYE+I RKG+TYYAIAL+++RIVEA Sbjct: 187 LASINGIPLKEYYKLSHKDFSKEHEEKILNCVRNAAYEVINRKGSTYYAIALSIKRIVEA 246 Query: 246 IIRDENSILPVSSIVDDVYGVKDVAISLPAIINKSGVVKVFDIPLTDEEKEKLKNSAQVI 305 + ++ENSIL S++++ YG++ V + +P II SGV + +PL E E L+NSA+V+ Sbjct: 247 LFKNENSILTTSTLLNGEYGIEGVFMGVPCIIGSSGVKSIIQVPLNKNESEALENSARVL 306 Query: 306 KSVIESLKL 314 K L + Sbjct: 307 KKTTAHLNI 315 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 315 Length adjustment: 27 Effective length of query: 287 Effective length of database: 288 Effective search space: 82656 Effective search space used: 82656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_012101770.1 CKL_RS06800 (L-lactate dehydrogenase)
to HMM TIGR01771 (L-lactate dehydrogenase (EC 1.1.1.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01771.hmm # target sequence database: /tmp/gapView.32628.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01771 [M=299] Accession: TIGR01771 Description: L-LDH-NAD: L-lactate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-126 406.2 2.8 4.9e-126 406.0 2.8 1.0 1 lcl|NCBI__GCF_000016505.1:WP_012101770.1 CKL_RS06800 L-lactate dehydrogen Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016505.1:WP_012101770.1 CKL_RS06800 L-lactate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.0 2.8 4.9e-126 4.9e-126 1 299 [] 10 308 .. 10 308 .. 0.99 Alignments for each domain: == domain 1 score: 406.0 bits; conditional E-value: 4.9e-126 TIGR01771 1 iiGagaVGssvafalltqgladelvliDinedkaegealdlsdaasflkskvkvkagdyedlkdadlvv 69 i+Gag VGss+afa++++gla+e+v++Din+ kaege++dl ++ sf+ ++ ++kagdy+d+kd+++v+ lcl|NCBI__GCF_000016505.1:WP_012101770.1 10 IVGAGFVGSSTAFAIMMSGLASEIVIVDINKAKAEGEVMDLVQGESFV-EPLSIKAGDYKDTKDSNIVI 77 8***********************************************.889***************** PP TIGR01771 70 itaGaeqkpgetRlelveknvkilksivkevvksgfdgillvvsNPvDiltyvvlklsglpkerviGsG 138 itaGa+q++g+tRlel++kn+ i+ksi++e+vk+++++ill+vsNPvD+l+y+++klsg+p++rviGsG lcl|NCBI__GCF_000016505.1:WP_012101770.1 78 ITAGAAQNHGQTRLELIDKNYIIFKSIIPEIVKYSPNSILLIVSNPVDVLAYMTYKLSGFPSDRVIGSG 146 ********************************************************************* PP TIGR01771 139 tvLdtaRlrrllaeklevdpksvhayvlGEHGdsevavwssakiagvplkelleekekekekelk.eie 206 tvLdt+Rl+++++++l+vd ++vh+yv+GEHGdse+a+ws a+i+g+plke+ + ++k+ +ke++ +i lcl|NCBI__GCF_000016505.1:WP_012101770.1 147 TVLDTSRLKYIISNELHVDIRDVHGYVMGEHGDSEIAAWSLASINGIPLKEYYKLSHKDFSKEHEeKIL 215 ***********************************************************8888777*** PP TIGR01771 207 kevrdaayeiiekKgaTsygiglavariveailkdekrvlpvsallegeygikdvylgvPavlgknGve 275 + vr+aaye+i++Kg+T+y+i+l+++rivea++k+e+++l+ s+ll+geygi++v++gvP+++g++Gv+ lcl|NCBI__GCF_000016505.1:WP_012101770.1 216 NCVRNAAYEVINRKGSTYYAIALSIKRIVEALFKNENSILTTSTLLNGEYGIEGVFMGVPCIIGSSGVK 284 ********************************************************************* PP TIGR01771 276 eilelkLseeEkeklkksaetlkk 299 +i++++L+++E+e+l++sa++lkk lcl|NCBI__GCF_000016505.1:WP_012101770.1 285 SIIQVPLNKNESEALENSARVLKK 308 **********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.77 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory