Align Amino-acid permease RocE (characterized)
to candidate WP_012101937.1 CKL_RS07600 amino acid permease
Query= SwissProt::P39137 (467 letters) >NCBI__GCF_000016505.1:WP_012101937.1 Length = 485 Score = 379 bits (974), Expect = e-110 Identities = 189/456 (41%), Positives = 284/456 (62%), Gaps = 11/456 (2%) Query: 4 NQDNGNQLQRTMKSRHLFMISLGGVIGTGFFLGTGFTINQAGPLGAVLSYLVGGFIMFLT 63 N + N+L+R +K+RHL MI++GG IGTG FL G TINQAGP GA+++Y G +++ Sbjct: 8 NNERDNELKRGLKTRHLSMIAIGGAIGTGIFLALGATINQAGPGGALVAYGCIGIMVYFL 67 Query: 64 MLCLGELAVAFPVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQLMQRWF 123 M LGE+A PVSGSF YATKF+ PA GFA GW YW WA+T A E ++ +M+ W Sbjct: 68 MTGLGEMATYMPVSGSFGVYATKFVDPALGFALGWNYWYNWAITVAAEMVAGALIMKYWL 127 Query: 124 PHIDVWIWCLVFAALMFILNAITTKAFAESEFWFSGIKILIILLFIILGGAAMFGLIDLK 183 P + +W + F A++ +LN ++ +A+ ESEFWF+GIK++ +++FI++G A + G+ + Sbjct: 128 PGVPAIVWSVCFLAVIVLLNLLSARAYGESEFWFAGIKVVTVIVFILVGVATIIGIFN-- 185 Query: 184 GGEQAPFLTHFYEDGLFPNGIKAMLITMITVNFAFQGTELIGVAAGESEDPEKTIPRSIK 243 G F + F G K++ + + F+FQGTEL+ +AAGESE+PEKTIP++I Sbjct: 186 -GNPVGFKNFTVGEAPFVGGFKSIFLVFLIAGFSFQGTELVDIAAGESENPEKTIPKAIN 244 Query: 244 QTVWRTLVFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIPYAADIMNFVILIALLSV 303 WR L+F++ +I V+ +IP+ AGV SPF VF++ GI AA +MN VIL ++LS Sbjct: 245 SIFWRILIFYIGTIFVVGAIIPYMNAGVDTSPFTLVFKKAGIAGAASLMNAVILTSVLSA 304 Query: 304 ANSGLYASTRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKFAQAETVY 363 NSG+YASTR+LY+MA + +A L K N RGVP+ SLI+T VA LT TVY Sbjct: 305 GNSGMYASTRMLYSMAKDKKAPAWLAKVNSRGVPVNSLILTTIVASACFLTGLYAESTVY 364 Query: 364 MVLLSLAGMSAQVGWITISLSQIMFRRKYIREGGKIEDLKFKTPLYPVLPLIGLTLNTVV 423 + L++ +G++ V W+ I++ FR+ Y+ + LK++ L+P+ P+I L L +V Sbjct: 365 VWLVAASGLAGFVAWLGIAICHYRFRKAYVAQNRDFGRLKYRAKLFPLGPIIALVLCIIV 424 Query: 424 LISLA--------FDPEQRIALYCGVPFMIICYIIY 451 ++ D + Y G+P + +I Y Sbjct: 425 ILGQGVTYFEANNIDWSGVTSSYIGLPLFLGLWIWY 460 Lambda K H 0.329 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 606 Number of extensions: 33 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 467 Length of database: 485 Length adjustment: 33 Effective length of query: 434 Effective length of database: 452 Effective search space: 196168 Effective search space used: 196168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory