Protein WP_012101937.1 in Clostridium kluyveri DSM 555
Annotation: NCBI__GCF_000016505.1:WP_012101937.1
Length: 485 amino acids
Source: GCF_000016505.1 in NCBI
Candidate for 20 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-lysine catabolism | lysP | hi | lysine-specific permease (characterized) | 57% | 98% | 574.3 | Histidine permease HisP | 50% | 479.9 |
| L-histidine catabolism | permease | med | Histidine permease HisP (characterized) | 50% | 99% | 479.9 | lysine-specific permease | 57% | 574.3 |
| L-arginine catabolism | rocE | med | Amino-acid permease RocE (characterized) | 40% | 100% | 381.7 | lysine-specific permease | 57% | 574.3 |
| L-alanine catabolism | cycA | lo | General amino-acid permease GAP2 (characterized) | 37% | 84% | 342.4 | lysine-specific permease | 57% | 574.3 |
| L-threonine catabolism | RR42_RS28305 | lo | D-serine/D-alanine/glycine transporter (characterized, see rationale) | 39% | 90% | 325.1 | lysine-specific permease | 57% | 574.3 |
| D-alanine catabolism | cycA | lo | L-alanine and D-alanine permease (characterized) | 37% | 91% | 316.6 | lysine-specific permease | 57% | 574.3 |
| L-phenylalanine catabolism | aroP | lo | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs (characterized) | 38% | 92% | 308.9 | lysine-specific permease | 57% | 574.3 |
| L-tryptophan catabolism | aroP | lo | Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) | 37% | 99% | 306.6 | lysine-specific permease | 57% | 574.3 |
| L-tyrosine catabolism | aroP | lo | Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) | 37% | 99% | 306.6 | lysine-specific permease | 57% | 574.3 |
| L-proline catabolism | proY | lo | proline-specific permease (proline transport protein) (characterized) | 35% | 91% | 303.5 | lysine-specific permease | 57% | 574.3 |
| phenylacetate catabolism | H281DRAFT_04042 | lo | Aromatic amino acid transporter AroP (characterized, see rationale) | 36% | 97% | 290.8 | lysine-specific permease | 57% | 574.3 |
| L-tryptophan catabolism | TAT | lo | tryptophan permease (characterized) | 34% | 85% | 287.7 | lysine-specific permease | 57% | 574.3 |
| L-isoleucine catabolism | Bap2 | lo | Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) | 36% | 87% | 287 | lysine-specific permease | 57% | 574.3 |
| L-leucine catabolism | Bap2 | lo | Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) | 36% | 87% | 287 | lysine-specific permease | 57% | 574.3 |
| L-valine catabolism | Bap2 | lo | Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) | 36% | 87% | 287 | lysine-specific permease | 57% | 574.3 |
| L-asparagine catabolism | ansP | lo | L-asparagine permease; L-asparagine transport protein (characterized) | 32% | 95% | 264.2 | lysine-specific permease | 57% | 574.3 |
| D-serine catabolism | cycA | lo | D-serine/L-alanine/D-alanine/glycine/D-cycloserine uptake porter of 556 aas, CycA (characterized) | 37% | 70% | 263.5 | lysine-specific permease | 57% | 574.3 |
| L-tyrosine catabolism | TAT1 | lo | valine/tyrosine/tryptophan amino-acid permease (characterized) | 30% | 79% | 259.2 | lysine-specific permease | 57% | 574.3 |
| L-serine catabolism | serP | lo | Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) | 32% | 100% | 236.5 | lysine-specific permease | 57% | 574.3 |
| L-threonine catabolism | serP1 | lo | Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) | 32% | 100% | 236.5 | lysine-specific permease | 57% | 574.3 |
Sequence Analysis Tools
View WP_012101937.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MESSVEQNNERDNELKRGLKTRHLSMIAIGGAIGTGIFLALGATINQAGPGGALVAYGCI
GIMVYFLMTGLGEMATYMPVSGSFGVYATKFVDPALGFALGWNYWYNWAITVAAEMVAGA
LIMKYWLPGVPAIVWSVCFLAVIVLLNLLSARAYGESEFWFAGIKVVTVIVFILVGVATI
IGIFNGNPVGFKNFTVGEAPFVGGFKSIFLVFLIAGFSFQGTELVDIAAGESENPEKTIP
KAINSIFWRILIFYIGTIFVVGAIIPYMNAGVDTSPFTLVFKKAGIAGAASLMNAVILTS
VLSAGNSGMYASTRMLYSMAKDKKAPAWLAKVNSRGVPVNSLILTTIVASACFLTGLYAE
STVYVWLVAASGLAGFVAWLGIAICHYRFRKAYVAQNRDFGRLKYRAKLFPLGPIIALVL
CIIVILGQGVTYFEANNIDWSGVTSSYIGLPLFLGLWIWYKKKYSTKVIKLEEVDFDSIE
EEVKL
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory