Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_012101939.1 CKL_RS07610 UDP-glucose 4-epimerase GalE
Query= SwissProt::P21977 (332 letters) >NCBI__GCF_000016505.1:WP_012101939.1 Length = 328 Score = 369 bits (947), Expect = e-107 Identities = 187/331 (56%), Positives = 248/331 (74%), Gaps = 4/331 (1%) Query: 1 MAILVLGGAGYIGSHMVDRLVEKGQEKVVVVDSLVTGHRAAVHPDAIFYQGDLSDQDFMR 60 M+ILV GGAGYIGSHM L+E+G+E +VV+D+ GH++AV + YQGDL D++ + Sbjct: 1 MSILVCGGAGYIGSHMAAELLERGKE-IVVLDNFEKGHKSAVLGGKV-YQGDLRDENAVD 58 Query: 61 KVFKENPDVDAVIHFAAYSLVGESMEKPLKYFDNNTAGMVKLLEVMNECGVKYIVFSSTA 120 KVF+EN ++++VI FAAYSLVGES+E+PLKYF+NN G + LL+ M + GVKYIVFSSTA Sbjct: 59 KVFEEN-NIESVIDFAAYSLVGESVEEPLKYFENNVVGTLNLLKSMRKYGVKYIVFSSTA 117 Query: 121 ATYGIPEEIPILETTPQNPINPYGESKLMMETIMKWSDQAYGIKYVPLRYFNVAGANLMV 180 ATYG P+ IPI E P NPYGESKL +E ++KWSD+AYGIKY LRYFN AGA++ Sbjct: 118 ATYGEPKNIPIFEDDSTYPTNPYGESKLTVEKLLKWSDRAYGIKYAALRYFNAAGAHISG 177 Query: 181 RLVRTRS-ETHLLPIILQVAQGVREKIMIFGDDYNTPDGTNVRDYVHPFDLADAHLLAVE 239 + + ETHL+PIILQVA R+KI IFGDDY+T DGT +RDYVH DLA+AHLLA+ Sbjct: 178 LIGEDHNPETHLIPIILQVALKKRDKIFIFGDDYSTEDGTCIRDYVHVMDLANAHLLALN 237 Query: 240 YLRKGNESTAFNLGSSTGFSNLQILEAARKVTGKEIPAEKADRRPGDPDILIASSEKART 299 + + +S +NLG+ GFS +++E +RKVTG++I AE A RR GDP+ LIASS+KA Sbjct: 238 KIIEDGKSGIYNLGNGRGFSVKEVIEVSRKVTGQKIKAEIAPRREGDPETLIASSKKAEE 297 Query: 300 VLGWKPQFDNIEKIIASAWAWHSSHPKGYDD 330 L WKP+++++E II +AW WH H G+++ Sbjct: 298 ELNWKPKYNSLETIIDTAWKWHKEHLNGFEE 328 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 328 Length adjustment: 28 Effective length of query: 304 Effective length of database: 300 Effective search space: 91200 Effective search space used: 91200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_012101939.1 CKL_RS07610 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.1166324.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-141 455.7 0.1 4.3e-141 455.5 0.1 1.0 1 NCBI__GCF_000016505.1:WP_012101939.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000016505.1:WP_012101939.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 455.5 0.1 4.3e-141 4.3e-141 2 330 .. 3 324 .. 2 326 .. 0.99 Alignments for each domain: == domain 1 score: 455.5 bits; conditional E-value: 4.3e-141 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeekidav 74 iLv GgaGyiGsh++ +lle+gke+vvlDn kg+k+a+ ++ +++gdl+d++++++v+ee++i++v NCBI__GCF_000016505.1:WP_012101939.1 3 ILVCGGAGYIGSHMAAELLERGKEIVVLDNFEKGHKSAVLGGK------VYQGDLRDENAVDKVFEENNIESV 69 9******************************************......9*********************** PP TIGR01179 75 iHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGr 147 i faa+ vgEsv+ePlkY+ennvv+tl+Ll++m+k+gvk ++Fss+aa+Yge++++pi E+ ++ p+npYG+ NCBI__GCF_000016505.1:WP_012101939.1 70 IDFAAYSLVGESVEEPLKYFENNVVGTLNLLKSMRKYGVKYIVFSSTAATYGEPKNIPIFEDDSTYPTNPYGE 142 ************************************************************************* PP TIGR01179 148 sklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkrekleifGtdyptk 220 skl+vE++lk +a +++k+++LRYFn+aGA+ +g iGe+++++thli+++++va+ kr+k+ ifG+dy t+ NCBI__GCF_000016505.1:WP_012101939.1 143 SKLTVEKLLKWSDRA-YGIKYAALRYFNAAGAHISGLIGEDHNPETHLIPIILQVALKKRDKIFIFGDDYSTE 214 **********99999.********************************************************* PP TIGR01179 221 DGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpas 293 DGtc+RDy+Hv+Dla+aHl al+++ e g+s +ynlG+g+gfsvkevie +kv+g++ik+e+a+rR+GDp + NCBI__GCF_000016505.1:WP_012101939.1 215 DGTCIRDYVHVMDLANAHLLALNKIIEDGKSGIYNLGNGRGFSVKEVIEVSRKVTGQKIKAEIAPRREGDPET 287 ************************************************************************* PP TIGR01179 294 lvadaskikrelgwkpkyddLeeiiksawdWekklke 330 l+a+++k+++el+wkpky+ Le+ii +aw+W+k++ + NCBI__GCF_000016505.1:WP_012101939.1 288 LIASSKKAEEELNWKPKYNSLETIIDTAWKWHKEHLN 324 *********************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (328 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 15.77 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory