Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate WP_012101948.1 CKL_RS07655 aspartate aminotransferase family protein
Query= SwissProt::P50457 (421 letters) >NCBI__GCF_000016505.1:WP_012101948.1 Length = 390 Score = 195 bits (495), Expect = 2e-54 Identities = 125/398 (31%), Positives = 204/398 (51%), Gaps = 40/398 (10%) Query: 30 ENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLA 89 E L D + EY+DF +GI V++ G+ + + + AVE QL++ HT+ + + + Sbjct: 26 EGCKLFDTDNKEYLDFTSGIGVMSLGYGNKNWIKAVEAQLEKVVHTSNIFLN----IPVL 81 Query: 90 EKINALAPVSGQAKTAFFTTGAEAVENAVKIARAHT------GRPGVIAFSGGFHGRTYM 143 E +S K F +GAEA E A+K+AR ++ R ++ FHGRT Sbjct: 82 ELAKKFTEISNMTKVFFCNSGAEANEGAIKLARKYSFDKHGKARNTILTLKKSFHGRTIT 141 Query: 144 TMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAII 203 T+ G+ +K F PF + + +++ +E+ S I AI+ Sbjct: 142 TLKAGGQEKLHKY-FYPFTEGFKYA-----------EANVEELEKSIDSSI-----CAIM 184 Query: 204 FEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLM 263 EP+QGEGG N +E V + + ++ I++I DE+Q G RTGK++ ++Y PD++ Sbjct: 185 IEPIQGEGGINPLSEEFVHKVFGIAEKEDILVICDEIQCGIGRTGKIYGFNNYGVCPDII 244 Query: 264 TMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERA 323 + AK L GG+P+ V+ N + + G G T+ GNP+ A A VLNII + S E Sbjct: 245 STAKGLGGGLPIGAVLCNEKLNNTFEYGDHGSTFGGNPVCAAGALEVLNIISENSFLEEV 304 Query: 324 NQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQGL 383 ++ G+ +K ++ I VRG+G MI +E GE A ++Q++AL +GL Sbjct: 305 SEKGKFVKEYF--KSKNKKNILEVRGMGLMIGIEIE----GE-----ASRVQKKALQKGL 353 Query: 384 LLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALSD 421 L+LT G NV+R L PL I + +A + L + + + Sbjct: 354 LVLTAGP--NVVRLLPPLIISKEELEAGLNTLYEIIEE 389 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 390 Length adjustment: 31 Effective length of query: 390 Effective length of database: 359 Effective search space: 140010 Effective search space used: 140010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory