Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_012102440.1 CKL_RS10300 3-oxoacyl-ACP reductase FabG
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000016505.1:WP_012102440.1 Length = 250 Score = 116 bits (291), Expect = 4e-31 Identities = 78/259 (30%), Positives = 145/259 (55%), Gaps = 22/259 (8%) Query: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSSTEVQGYAL 60 M LKDKV ++TG + G+G A+A A+ GA++ +++ + K ++A + +++G ++ Sbjct: 1 MKLKDKVAIVTGASRGIGKAIAIEMAKEGARI-IVNYNNSK-KKALEVVKEIEDIKGTSI 58 Query: 61 ----DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQS 116 D++ +V +E+FG+I++LVNNAGIL+ K + ++ D++ Sbjct: 59 AVKADVSKRNEVKKMIDIAVENFGEIHILVNNAGILQQ---------KPFESITDDEWDK 109 Query: 117 VINVNLTGTFLCGREAAAAMIESGQAGVIVNISSLAK--AGNVGQSNYAASKAGVAAMSV 174 + VN+ G F+C +E M+++ G I+NISS+ GN+ +Y+A+KAG+ +++ Sbjct: 110 MFQVNMKGAFICTQECIPYMLKN-NFGRIINISSIGGQWGGNLA-VHYSATKAGIISLAR 167 Query: 175 GWAKELARYNIRSAAVAPGVIATEMTA-AMKPEALERLEKLVPVGRLGHAEEIASTVRFI 233 A+ ++ I + +APG++ TEM+A M EA + K +P+ R EEI F+ Sbjct: 168 SLARIYSKDGINTNCIAPGLVLTEMSAKEMATEAGKEKLKGIPINRPAAPEEIGRIAVFL 227 Query: 234 IEND--YVNGRVFEVDGGI 250 D Y+ G+ +GG+ Sbjct: 228 ASEDGSYITGQTLNANGGM 246 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 250 Length adjustment: 24 Effective length of query: 228 Effective length of database: 226 Effective search space: 51528 Effective search space used: 51528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory