Align NAD+-dependent L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_012102549.1 CKL_RS10825 aldehyde dehydrogenase
Query= metacyc::MONOMER-16246 (477 letters) >NCBI__GCF_000016505.1:WP_012102549.1 Length = 474 Score = 141 bits (355), Expect = 5e-38 Identities = 105/332 (31%), Positives = 157/332 (47%), Gaps = 11/332 (3%) Query: 143 GVVAGILPWNFPFFLIARKMAPALLTGNTIVVKPSEETP--NNCFEFARLVAETDLPRGV 200 GV I PWNFPF L + A+ GN +++KPSE TP NC + + V Sbjct: 114 GVSLIISPWNFPFQLAISPLVSAIAAGNCVILKPSEYTPLTGNCIKKMISCIFQEDEVAV 173 Query: 201 FNVVCGAGQVGGALSSHPGVDLISFTGSVETGARIMAAAAPNLTKLNLELGGKAPAIVLA 260 F G ++ L P + I FTGS G IM AAA NL + LELGGK+P I+ Sbjct: 174 FE---GDYRISKMLLEKP-FENIFFTGSPTVGKMIMEAAAKNLATVTLELGGKSPVIIHP 229 Query: 261 DADLELAVKAIRDSRIINSGQVCNCAERVYVQRQVAEPFIERIAAAMAATRYGDPLAEPE 320 A+L+ A I + +N+GQ+C + + + + E F E + YG + + Sbjct: 230 SANLDEAAGRIAWGKCLNAGQICVAPDYLLIPQNKEEVFTE-LMVKYIIQYYGTFKKDMD 288 Query: 321 -VEMGPLINRLGLEKIDAKVRTALAQGATLVTGGAIAERPGHHYQPTVLTGCRADTRIMR 379 ++ +I + +I V A+ +GA + GG E Y PT++T +++I+ Sbjct: 289 NLKYSRIITKEHFFRIKELVEEAVYKGAKIRCGGYFNECDNFIY-PTIITNVDLNSKILE 347 Query: 380 EEIFGPVLPIQIVDDLDEAIALANDCEYGLTSSVFTRDLNKAMHALRELDFGETYINR-- 437 EEIFGPVLPI + +DEA+ L +F+RD + L + G+ IN Sbjct: 348 EEIFGPVLPIISYESMDEALEYIKSKPKPLVIYIFSRDKKAVNYLLDNTESGDAVINDVV 407 Query: 438 EHFEAMQGFHAGVRKSGIGGADGKHGLYEYTH 469 H + G SGIG + G +G +TH Sbjct: 408 VHAGNINLPFGGFNNSGIGKSHGYYGFMAFTH 439 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 474 Length adjustment: 33 Effective length of query: 444 Effective length of database: 441 Effective search space: 195804 Effective search space used: 195804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory