Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate WP_012102749.1 CKL_RS11765 aspartate aminotransferase family protein
Query= BRENDA::Q9I6J2 (456 letters) >NCBI__GCF_000016505.1:WP_012102749.1 Length = 452 Score = 227 bits (579), Expect = 5e-64 Identities = 144/444 (32%), Positives = 230/444 (51%), Gaps = 33/444 (7%) Query: 18 RDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQA 77 + ++L ++ K+LN +ITKAEG+Y WDS G K D + L +N+G+G ++++ A Sbjct: 21 KKYNLHSWSAQKKLNPL---VITKAEGIYFWDSTGKKYFDMSSQLVNLNIGHGNKKVINA 77 Query: 78 ATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHY 137 Q ++PF + A +LA + + APE M VFFT G+++N+ +++ Sbjct: 78 IKEQADKMPFIGPGY--AVDVRSKLAAKVIEKAPENMGKVFFTLGGADSNENAIKIA--- 132 Query: 138 WATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALH--EQGDFPIPGIVHIAQPYWYGEG 195 K K + R+ YHG++ +L G + E G IPG V PY Y E Sbjct: 133 ---KMATGKFKIFSRYRSYHGASFGAANLTGEPRRYTCEPG---IPGFVKFFDPYIYRES 186 Query: 196 GDM-SPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAK 254 S +E + +L+++++ G E VAA E + G+ GVI+PP Y IR++ + Sbjct: 187 IRFESEEEACEYYLGKLKEQLIYEGTETVAAIFLETVTGSNGVIIPPKGYLQGIRKLCDE 246 Query: 255 YDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLN 314 + I+ + DEV+ G+GRTGEWF + PD++ AKG+T GY+PMGGV+V +I E + Sbjct: 247 FGIVMVCDEVMAGWGRTGEWFACNNWDVEPDIITFAKGVTCGYVPMGGVIVSKKIGEYFD 306 Query: 315 QGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGE 374 G TY+ HP+ A I + EE +IE K +K Q H VG+ Sbjct: 307 D-NVLMCGLTYNAHPLGCAAGCATIEVYEEENLIENSKKMGVVLGEKLEQIKQKHASVGD 365 Query: 375 ARGVGMVAALELVKNKKTRERFTDKG----------VGMLCREHCFRNGLIMRAVGDTMI 424 R +G+ +A+ELVK+K TRE G VGML + G + + ++ Sbjct: 366 VRYIGLFSAVELVKDKNTREALVPYGRDPEGIMGKIVGMLKEK-----GFSTYSHENCIM 420 Query: 425 ISPPLVIDPSQIDELITLARKCLD 448 ++PPL+I +++E + + K LD Sbjct: 421 VAPPLIIKKEELEEAMDILDKVLD 444 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 37 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 452 Length adjustment: 33 Effective length of query: 423 Effective length of database: 419 Effective search space: 177237 Effective search space used: 177237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory