Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_012103136.1 CKL_RS13685 3-hydroxybutyryl-CoA dehydrogenase
Query= BRENDA::C4IEM5 (282 letters) >NCBI__GCF_000016505.1:WP_012103136.1 Length = 319 Score = 190 bits (482), Expect = 4e-53 Identities = 115/287 (40%), Positives = 169/287 (58%), Gaps = 8/287 (2%) Query: 1 MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEA 60 +K V VLG GTMG GIVQ A G V + + ++RG +I SL L K KI Sbjct: 3 IKNVAVLGTGTMGNGIVQLCAESGLNVNMFGRTDASLERGFTSIKTSLKNLEEKGKIKTN 62 Query: 61 DKEEILSRISGTTDMKLAAD-CDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSL 119 +EIL RI G ++ A + D V+E E++++K+E+F++LD IC PE ILASNTS L Sbjct: 63 ISKEILKRIKGVKTIEEAVEGVDFVIECIAEDLELKQEVFSKLDEICAPEVILASNTSGL 122 Query: 120 SITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEV 179 S T++A TK ++V+ HF+NP + LVEV+ G T +T D + E IGK V++ Sbjct: 123 SPTDIAINTKHPERVVIAHFWNPPQFIPLVEVVPGKHTDSKTVDITMDWIEHIGKKGVKM 182 Query: 180 -AEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPM---GPLALGDLIGL 235 E GF+ NR+ + ++ EA +I+++G A E++D A++ G + GP+ DL GL Sbjct: 183 RKECLGFIGNRLQLALLREALYIVEQGFATAEEVDKAIEYGHGRRLPVTGPICSADLGGL 242 Query: 236 DVCLAIMDVLYNE-TGDTKYRASSLLRKYVRAGWLGRKTGKGFYDYS 281 D+ I L+ + DT+ S LL+ V G LG KTGKGFY+++ Sbjct: 243 DIFNNISSYLFKDLCNDTE--PSKLLKSKVDGGNLGSKTGKGFYNWT 287 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 319 Length adjustment: 27 Effective length of query: 255 Effective length of database: 292 Effective search space: 74460 Effective search space used: 74460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory