Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_012103942.1 CKL_RS17630 branched-chain amino acid aminotransferase
Query= reanno::pseudo5_N2C3_1:AO356_22970 (339 letters) >NCBI__GCF_000016505.1:WP_012103942.1 Length = 344 Score = 503 bits (1296), Expect = e-147 Identities = 232/337 (68%), Positives = 280/337 (83%) Query: 3 NESINWDKLGFDYIKTDKRYLSHWRDGAWDAGTLTDDNVLHISEGSTALHYGQQCFEGLK 62 N +I+W++LGFDYIKTD RY+S W+DG+WD G L +DN+L ISEGS ALHYGQQCFEGLK Sbjct: 4 NINIDWNELGFDYIKTDFRYISVWKDGSWDDGKLVEDNMLTISEGSPALHYGQQCFEGLK 63 Query: 63 AYRCKDGSINLFRPDQNAARMQRSCARLLMPQVETEQFVEACKQVVRANERFIPPYGTGG 122 YR KDG I LFRPDQNA R+ SC RLLMP++ E+F+ AC QV +ANE ++ P+GTG Sbjct: 64 CYRRKDGKIQLFRPDQNAKRLNNSCRRLLMPEIPEEKFISACVQVAKANEEYVAPHGTGA 123 Query: 123 ALYLRPFVIGVGDNIGVRTAPEFIFSIFCIPVGAYFKGGLTPHNFLISSFDRAAPQGTGA 182 LY+RPF+IGVGDNIGV+ A E+IF +FC PVG YFKGG+TP NF+IS +DRAAP GTGA Sbjct: 124 TLYIRPFIIGVGDNIGVKPAEEYIFCVFCCPVGPYFKGGVTPVNFMISDYDRAAPYGTGA 183 Query: 183 AKVGGNYAASLMPGSQAKKASFADCIYLDPMTHSKIEEVGSANFFGITHDNTFVTPRSPS 242 AKVGGNYAASL+P + K FADCIYLDP TH+KIEEVG+ANFFGIT DN FVTP+SPS Sbjct: 184 AKVGGNYAASLLPHENSAKRGFADCIYLDPATHTKIEEVGAANFFGITKDNKFVTPKSPS 243 Query: 243 VLPGITRLSLIELAKSRLGLEVIEGDVFIDKLSDFKEAGACGTAAVITPIGGISYKDKLH 302 +LP IT+ SL+ +AK LG++V E DV+IDK+ +F EAGACGTAAVITPIGGI YKDKLH Sbjct: 244 ILPSITKYSLLYIAKEYLGMQVEERDVYIDKIYEFAEAGACGTAAVITPIGGIEYKDKLH 303 Query: 303 VFHSETEVGPITQKLYKELTGVQTGDVEAPAGWIVKV 339 VF+SETEVGP+T+KLY L G+Q GDV+AP GWI+++ Sbjct: 304 VFYSETEVGPVTKKLYDTLYGIQFGDVKAPQGWIIEI 340 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 344 Length adjustment: 29 Effective length of query: 310 Effective length of database: 315 Effective search space: 97650 Effective search space used: 97650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012103942.1 CKL_RS17630 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01123.hmm # target sequence database: /tmp/gapView.453570.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-143 461.5 0.0 6.4e-143 461.4 0.0 1.0 1 NCBI__GCF_000016505.1:WP_012103942.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000016505.1:WP_012103942.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.4 0.0 6.4e-143 6.4e-143 1 313 [] 32 340 .. 32 340 .. 0.99 Alignments for each domain: == domain 1 score: 461.4 bits; conditional E-value: 6.4e-143 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeelflea 73 Wd+++l++++ l+++egs +lhYgq++feGlk yR +dGki lfRpd+nakRl++s++rll+Pe++ee f+ a NCBI__GCF_000016505.1:WP_012103942.1 32 WDDGKLVEDNMLTISEGSPALHYGQQCFEGLKCYRRKDGKIQLFRPDQNAKRLNNSCRRLLMPEIPEEKFISA 104 ************************************************************************* PP TIGR01123 74 lkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsifveteyvRa 146 + q+ ka++++v++++++a+LY+RPf+i+++dn+Gvk+a+ey+f+v+++PvG+Yfkgg++p +f+ ++y+Ra NCBI__GCF_000016505.1:WP_012103942.1 105 CVQVAKANEEYVAPHGTGATLYIRPFIIGVGDNIGVKPAEEYIFCVFCCPVGPYFKGGVTP-VNFMISDYDRA 176 *************************************************************.788899***** PP TIGR01123 147 apkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelvttplsesiLegv 219 ap GtGa+kvgGnYaasll++++ a++g++d++yldp++++kieevGaan+f+itkd ++++tp+s+siL+++ NCBI__GCF_000016505.1:WP_012103942.1 177 APYGTGAAKVGGNYAASLLPHENSAKRGFADCIYLDPATHTKIEEVGAANFFGITKD-NKFVTPKSPSILPSI 248 *********************************************************.*************** PP TIGR01123 220 tresllelakd.lgleveereiaidelkaaveaGeivfacGtaavitPvgelkiegkevevkse.evGevtkk 290 t++sll +ak+ lg++veer+++id++++++eaG acGtaavitP+g+++ ++k ++++se evG+vtkk NCBI__GCF_000016505.1:WP_012103942.1 249 TKYSLLYIAKEyLGMQVEERDVYIDKIYEFAEAG----ACGTAAVITPIGGIEYKDKLHVFYSEtEVGPVTKK 317 **********************************....************************999******** PP TIGR01123 291 lrdeltdiqyGkledkegWivev 313 l+d+l +iq+G++++++gWi+e+ NCBI__GCF_000016505.1:WP_012103942.1 318 LYDTLYGIQFGDVKAPQGWIIEI 340 ********************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.97 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory