Align Arabinose-proton symporter; Arabinose transporter (characterized)
to candidate WP_012112845.1 XAUT_RS04135 MFS transporter
Query= SwissProt::P0AE24 (472 letters) >NCBI__GCF_000017645.1:WP_012112845.1 Length = 444 Score = 236 bits (601), Expect = 2e-66 Identities = 142/446 (31%), Positives = 233/446 (52%), Gaps = 26/446 (5%) Query: 33 GLLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSL 92 G+LFG IAG + I F L++R E VV+S+++G IGA +S R+GR+ + Sbjct: 15 GILFGFSTASIAGVVEAIAQAFALSTRATEMVVTSLLVGCFIGAAAAAPVSARIGRRPAC 74 Query: 93 MAGAILFVLG----SIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGK 148 + A+L + G +G A ML+AAR+++G+ VG++S P+Y +E+ RG Sbjct: 75 LLAAVLAMAGYSLIPLGQGVAPGAGMLVAARILIGLGVGLSSMVVPMYAAEVTPARHRGA 134 Query: 149 MISMYQLMVTLGIVLAFLSDTAFSYSGNWRAMLGVLALPAVLLIILVVFLPNSPRWLAEK 208 ++S++QL +TLGI+ + A +W+ MLG L A +V+ LP SPRWL + Sbjct: 135 VVSLFQLAITLGILAGYAVPLALIGRASWQQMLGGGVLVAAACAAIVLLLPESPRWLRSR 194 Query: 209 GRHIEAEEVLRMLRDTSEKAREELNEIRESLKLKQGGWALFKINRNVRRAVF-LGMLLQA 267 G A+ R L + E E + W + R AV L +L Sbjct: 195 GMSARADAAARALGISDEMGEEHAPD--------GANWRAV-LGRGATGAVLVLCSVLFV 245 Query: 268 MQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIATLVVGLTFMFATFIAVFTVDKAGRKPAL 327 +Q F+G++ I+YYAP IF GF + AT +GL + AT A+ VD+ GR+P L Sbjct: 246 LQNFSGIDGILYYAPHIFTELGFPAGTAALAATFGLGLFNVIATIAAMALVDRLGRRPLL 305 Query: 328 KIGFSVMA--LGTLVLGYCLMQFDNGTASSGLSWLSVGMTMMCIAGYAMSAAPVVWILCS 385 +G + MA LG +++ A + W+++ I +A+S P+ ++L S Sbjct: 306 IVGSAAMAVSLGAVIV----------AALADWPWVALAGLCAYIVAFALSLGPLPYVLMS 355 Query: 386 EIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLDSIGAAGTFWLYTALNIAFVGITFWL 445 E+ P R+ GI ++ T+W+ N I+ TFL+++ IG AGT ++ + + + ++ Sbjct: 356 ELFPSAIRERGIAVASATSWLFNGIVAGTFLSVVQGIGLAGTIGIFFVVCVLSLVVSVLF 415 Query: 446 IPETKNVTLEHIERKLMAGEKLRNIG 471 +PET+ + LE IE ++ G LR +G Sbjct: 416 VPETRRIGLEEIEADVLDGRPLRQLG 441 Lambda K H 0.327 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 534 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 444 Length adjustment: 33 Effective length of query: 439 Effective length of database: 411 Effective search space: 180429 Effective search space used: 180429 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory