Align ABC transporter permease (characterized, see rationale)
to candidate WP_012113068.1 XAUT_RS05260 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KC95 (309 letters) >NCBI__GCF_000017645.1:WP_012113068.1 Length = 289 Score = 192 bits (489), Expect = 6e-54 Identities = 104/299 (34%), Positives = 171/299 (57%), Gaps = 20/299 (6%) Query: 5 LQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPGA 64 LQ +++G+V+GS+Y LI +G+T ++ + ++NFA G+ M+GA+T+ + + G Sbjct: 5 LQFLLSGIVVGSIYGLIGVGFTCIFNVTGIVNFAQGDFAMVGAMTTIALLSA------GV 58 Query: 65 PGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMIIWK 124 P + ++LA ++ C+VAA +IE+ A RP+RS + +I IG+ ++L +A ++W Sbjct: 59 PLPIAIVLAIVVTCLVAA----IIERTAIRPVRSDV-VRGIIVTIGIGVILHGVAALVWG 113 Query: 125 PNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRATAENP 184 + +P P +P IGGA I+P + ++G A+ L L T LG+ RA A NP Sbjct: 114 TDAQPMPAFSGDAPIRIGGATISPQALWVVGAAMTAMVLLELLFRKTFLGQMFRACAINP 173 Query: 185 RVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGGI 244 A L+G++ + +F++ L AIAGI+ A Q+ G G+K F A + GG Sbjct: 174 FAAGLVGIRVGTMSLISFVMSGALGAIAGIVVAP-IALTQYDSGLQLGIKGFVACIVGGF 232 Query: 245 GNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGLLGE 303 G GA +GGILLG++EA +GY+ S Y + AF++L++ L RP GL G+ Sbjct: 233 GGPIGAALGGILLGILEAFAAGYV--------SSGYKNAIAFVLLLVFLLFRPGGLFGD 283 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 289 Length adjustment: 27 Effective length of query: 282 Effective length of database: 262 Effective search space: 73884 Effective search space used: 73884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory