Align oxepin-CoA hydrolase (EC 3.3.2.12) (characterized)
to candidate WP_012115479.1 XAUT_RS17675 aldehyde dehydrogenase family protein
Query= BRENDA::P77455 (681 letters) >NCBI__GCF_000017645.1:WP_012115479.1 Length = 522 Score = 89.0 bits (219), Expect = 5e-22 Identities = 109/364 (29%), Positives = 154/364 (42%), Gaps = 43/364 (11%) Query: 149 GVAVHINAFNFPCWGMLEKLAPTWLGGMPAIIKPATATAQLTQAMVKSIVDS-----GLV 203 GV I+AFNFP A + G + KP+ T LT V +I G V Sbjct: 164 GVVGVISAFNFPVAVWSWNAALALVCGNAVVWKPSEKTP-LTALAVDAIFSRATARFGGV 222 Query: 204 PEGAISLICGS--AGDLLDHLDSQDVVTFTGSAATGQMLRVQPNIVAKSIPFTMEADSLN 261 PEG +L+ G AG+ L VV+ TGS A G+ V P I + +E N Sbjct: 223 PEGLSTLLLGGREAGEALVDDPRVPVVSATGSTAMGRA--VAPRIARRFGRAILELGGNN 280 Query: 262 CCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRRIIVPQALVNAVSDALVARLQK 321 ++ D L +R V AGQ+CT++RR+ V + +V DALV RL + Sbjct: 281 AAIVCPSADLD-----LTLRAVAFAAMGTAGQRCTSLRRLFVHE----SVYDALVPRLHQ 331 Query: 322 ----VVVGDPAQEGVKMGALVNAEQRADVQEKVNILLAAGCEI----RLGGQADLSAAGA 373 V VGDP + G +G L++ +Q + AAG + RLG + L A Sbjct: 332 AYGSVPVGDPRELGTLVGPLIDENAYTAMQSALEDARAAGGLVSGGERLGAEDALDA--Y 389 Query: 374 FFPPTLLYCP-QPDETPAVHATEAFGPVATLMPAQNQRHALQLACAGGGSLAGTLVTADP 432 + P L+ P Q D A E F P+ ++ N A+ L A LA ++ T D Sbjct: 390 YVRPALVEMPFQAD----CVAAETFAPILYVIRYSNLDEAIGLNNAVPQGLASSIFTTDL 445 Query: 433 QIARQFIADAARTHGRIQILNEESAKESTGHGSPLPQLVHGGPGRAGGGEELGGLRAVKH 492 + A +F++ G + S E G GG GGG E G + K Sbjct: 446 REAERFLSATGSDCGIANVNIGPSGAEIGG--------AFGGEKETGGGREAGS-DSWKA 496 Query: 493 YMQR 496 YM+R Sbjct: 497 YMRR 500 Lambda K H 0.319 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 757 Number of extensions: 47 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 681 Length of database: 522 Length adjustment: 37 Effective length of query: 644 Effective length of database: 485 Effective search space: 312340 Effective search space used: 312340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory