Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_012168837.1 AZC_RS01555 acetyl-CoA C-acetyltransferase
Query= metacyc::MONOMER-3207 (400 letters) >NCBI__GCF_000010525.1:WP_012168837.1 Length = 392 Score = 323 bits (829), Expect = 4e-93 Identities = 181/400 (45%), Positives = 247/400 (61%), Gaps = 15/400 (3%) Query: 3 DVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQAGE 62 DV I A RTP+G F GAL+ + A L A+ +KA +E V +V EV G A + Sbjct: 4 DVVIVSAARTPVGSFNGALSTLPAHQLGAIAIKAALE-RAGVAASEVSEVILGQVLTAAQ 62 Query: 63 DNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESMSR 122 +N AR A + AG+P P +N++C SG+ ++ ++AI +G+ L +AGG ESMS+ Sbjct: 63 -GQNPARQASIAAGVPIESPAWQVNQVCGSGLRSVALGYQAIKNGDSSLVVAGGQESMSQ 121 Query: 123 APFVMGKAESGYSRNMKLEDTTIG---WRFINPLMKSQYGVDSMPETADNVADDYQVSRA 179 + ++ L DT I W N M TA+NVA +Q++RA Sbjct: 122 STHAAHLRNGTRMGSLDLVDTMIKDGLWDAFNGY--------HMGNTAENVATQFQITRA 173 Query: 180 DQDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEHLRPETTLEALTKLKP 239 +QD FA+ SQ KA AAQ AG F EEIVPV I+ +KG+ +V+ DE+ R T+EA+ KLKP Sbjct: 174 EQDEFAVASQHKAEAAQKAGRFKEEIVPVTISSRKGDVVVDTDEYPRHGATIEAMQKLKP 233 Query: 240 VNGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPV 299 D TVTA NASG+NDG AA++L SAE K G TP AR++ A GV P VMG GP+ Sbjct: 234 AFVKDGTVTAANASGINDGGAAVVLMSAERAAKEGKTPLARIVSWAQAGVDPAVMGTGPI 293 Query: 300 PAVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLG 359 PA + E+ G V D D+IE NEAFA+Q +AV + LG D +VN NGGAIA+GHP+G Sbjct: 294 PASKLALEKAGWTVDDLDLIEANEAFAAQAIAVNKGLGW--DTAKVNVNGGAIAIGHPIG 351 Query: 360 MSGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIER 399 SG R+++T LH+++K +KGLAT+C+G G G+AL +ER Sbjct: 352 ASGTRILVTLLHEMQKRDAKKGLATLCIGGGMGIALCVER 391 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 392 Length adjustment: 31 Effective length of query: 369 Effective length of database: 361 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory