Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_012169464.1 AZC_RS04790 KR domain-containing protein
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000010525.1:WP_012169464.1 Length = 253 Score = 269 bits (687), Expect = 5e-77 Identities = 147/255 (57%), Positives = 178/255 (69%), Gaps = 2/255 (0%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60 M + +V+GAASGLGA TA+ L AGAKV L+D + A E+G A FA D+ Sbjct: 1 MDVKGHAAVVTGAASGLGAVTARALAAAGAKVALLDREVEGAARVAAEIGGQA-FA-CDV 58 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120 D +A++AV AA +A G LVNCAG+ A +++G++GP L F +V+ +NLIG+FN Sbjct: 59 VDAASAEAAVAAAAAAHGPARILVNCAGVAPAGRIVGRKGPQPLEDFRRVVEINLIGTFN 118 Query: 121 LLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELA 180 LLRL AA GERGV+INTASIAAYDGQ+GQ AYAASK +A LTLPAARE A Sbjct: 119 LLRLVAAGAVGLEPLARGERGVLINTASIAAYDGQVGQPAYAASKAGVAGLTLPAAREFA 178 Query: 181 RFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENSMLN 240 GIRV+TIAPGIF TPMM M EV+ S+ A VPFPP LG P++YA L HII N+MLN Sbjct: 179 GVGIRVVTIAPGIFATPMMLNMPQEVQDSIGATVPFPPGLGDPEDYARLVLHIIGNTMLN 238 Query: 241 GEVIRLDGALRMAAK 255 GEVIRLDGALRMA K Sbjct: 239 GEVIRLDGALRMAPK 253 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory