Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_012170796.1 AZC_RS11735 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000010525.1:WP_012170796.1 Length = 249 Score = 120 bits (302), Expect = 2e-32 Identities = 81/248 (32%), Positives = 124/248 (50%), Gaps = 14/248 (5%) Query: 10 GLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEK 69 G VAV+TGGA+G+GLA A+R++ +G + D + E LG N + DV+ Sbjct: 9 GRVAVVTGGAAGIGLAIAQRIIAEGGKVAIWDRDPAAIETAKAGLGANAIGVALDVSDWP 68 Query: 70 DVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVI 129 V+ A FG++D+ V AGI + T T+ +ED+++V+D+NL G F Sbjct: 69 AVEAAAKTVADTFGQIDILVASAGITGPNTT-----TWTYPVEDWRKVIDINLNGVFYCD 123 Query: 130 RLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPI 189 + V M + + G I+N AS+A EG AYSASK G++G+T + ++LA Sbjct: 124 KAVVPYMLEKD------YGRIVNIASIAGKEGNPNAPAYSASKAGVIGLTKSLGKELAKN 177 Query: 190 GIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLV--QAIIENPFLN 247 I V + P T + + + +F+ S++P R G E A LV A E F Sbjct: 178 KITVNCVTPAAVRTAIFDQMTQAHIDFMLSKIPM-GRFGQIEEVAALVCWLASEECSFST 236 Query: 248 GEVIRLDG 255 G V + G Sbjct: 237 GGVFDVSG 244 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 249 Length adjustment: 24 Effective length of query: 237 Effective length of database: 225 Effective search space: 53325 Effective search space used: 53325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory