Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate WP_012171493.1 AZC_RS15340 long-chain fatty acid--CoA ligase
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >NCBI__GCF_000010525.1:WP_012171493.1 Length = 549 Score = 228 bits (580), Expect = 6e-64 Identities = 174/538 (32%), Positives = 275/538 (51%), Gaps = 49/538 (9%) Query: 54 GRRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINP 113 GR +TYAQL R A+ L +G+ PG RVG+ N V+ A + G ++VN +P Sbjct: 35 GRCWTYAQLGGLVDRAAAGLQRLGVVPGTRVGLCLPNTPYSVIFYFAVLKAGGIVVNFSP 94 Query: 114 AYRTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTV 173 Y E+++ + G ++V P+ + A+ LKT+ Sbjct: 95 LYVERELKHQIRDSGTTIMV-----------------VPDLRIIHSRVAAVAEEAGLKTI 137 Query: 174 VWIDDEAGQGADEPGLLRFTELIARGNAA-----DPR---LAQVAAGLQATDPINI---- 221 + + AG + GLL L R + A D R L + A + A P+ + Sbjct: 138 I-VCPFAGILSPLKGLL--FNLFKRKDKAVYDTSDGRHVTLKTLTADVPALKPVLVDAER 194 Query: 222 -----QFTSGTTGFPKGATLTHRNILNNGFFIGECMK-LTPA-DRLCIPVPLYHCFGMV- 273 Q+T GTTG PKGA LTH + +N + + + LTP +R+ +PL+H F M Sbjct: 195 EVAVLQYTGGTTGVPKGAMLTHAAVASNARQVIDHVDCLTPGGERVLGVLPLFHVFAMTT 254 Query: 274 LGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFNLST 333 + N+ I+ P F +L+T+ R T GVPT++ A + P +L++ Sbjct: 255 VMNIPIALGAEIILVPR--FQLADLLKTIARTRPTLFPGVPTIYGAINNAPETQPQDLAS 312 Query: 334 LRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVSTVGQV 393 L+ I G+P P EV R E + ++ YG++ETSPV ++ T + K S VG+ Sbjct: 313 LKLCISGGAPLPVEVRHRF-EALTGCKLVEGYGLSETSPV-LTANPPTGIIKDGS-VGKA 369 Query: 394 QPH--LEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDL 451 P LE++ ++ T ++ +G++GE C +G VM GYW +TR A +G + TGD+ Sbjct: 370 VPQTVLEIRSLEDPT-RILGVGEKGEVCARGPQVMLGYWNRPEETRSAFVDGAF-RTGDV 427 Query: 452 ATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCA 511 +DA+GY+ +V RIKD+++ GG N+YPR IEE LY HP V + V+GVPD G+ A Sbjct: 428 GYVDADGYLFLVDRIKDVILCGGFNVYPRMIEEALYLHPAVAEAVVIGVPDPYRGQAPKA 487 Query: 512 WIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRDEMKDQ 569 ++ K G T DD+RAF Q++ ++P+ + S P T+ GK+ K ++ DE + + Sbjct: 488 FVTLKAGETVTGDDLRAFLIKQVSKVEMPKEVEVRDSLPRTLVGKLSKKELVDEERQR 545 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 736 Number of extensions: 41 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 549 Length adjustment: 36 Effective length of query: 542 Effective length of database: 513 Effective search space: 278046 Effective search space used: 278046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory