Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_012173058.1 AZC_RS23265 NAD(P)-dependent oxidoreductase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000010525.1:WP_012173058.1 Length = 254 Score = 125 bits (314), Expect = 8e-34 Identities = 96/256 (37%), Positives = 134/256 (52%), Gaps = 28/256 (10%) Query: 5 NKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARE----LGDNARFAVADI 60 N IV+G ASG+G A + L+ G +V+ D+ A+ + A ARE G+ RFA D+ Sbjct: 5 NGSVIVTGGASGIGLALVEALLTEGWRVVAADVVAENI-ASARESLARFGNQVRFAQIDV 63 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLAS---FAKVINVNLIG 117 SDE V+ + FG L G+VN AGI GK P S F K+++VNLIG Sbjct: 64 SDEAGVSHMVEEIDAEFGPLWGVVNSAGI-------GKDVPVFETSVDYFRKILDVNLIG 116 Query: 118 SFNLLRLAAAAM-AEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAA 176 +F + R A AM A G G I+N AS++ G +G+AAY +SK + LT A Sbjct: 117 TFLVAREGAKAMKAHGG-------GSIVNIASVSGLRGNLGRAAYGSSKAGVVMLTQIMA 169 Query: 177 RELARFGIRVMTIAPGIFETPMMAGM-SDEVRASLAAGVPFPPRLGRPQEYAALARHIIE 235 ELA IRV IAPG ETP++ M +DE RA VP R P E + +++ Sbjct: 170 VELAPEKIRVNAIAPGPIETPLVKRMHTDEARAGWMKEVPM-RRYADPSEVSGAISFLLD 228 Query: 236 ---NSMLNGEVIRLDG 248 +S + G+ + +DG Sbjct: 229 EQKSSFVTGQTLAVDG 244 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 254 Length adjustment: 24 Effective length of query: 231 Effective length of database: 230 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory