Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_012282976.1 HM1_RS08620 aminodeoxychorismate/anthranilate synthase component II
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_000019165.1:WP_012282976.1 Length = 195 Score = 256 bits (653), Expect = 2e-73 Identities = 124/190 (65%), Positives = 149/190 (78%), Gaps = 5/190 (2%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 M+++IDNYDSFTYNLVQY GE+ V+V RND ++ E I LAP IV+SPGPCTPNEAG Sbjct: 1 MIVVIDNYDSFTYNLVQYLGEMVDAVEVYRNDAIAPEAIAGLAPSHIVISPGPCTPNEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 +S+ VI R+AG++P+LGVCLGHQSIGQ FGG V+RA ++MHGKTSPI+H +FAGL N Sbjct: 61 ISMDVIGRYAGQIPILGVCLGHQSIGQVFGGRVIRASRLMHGKTSPIYHDGRTIFAGLPN 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 P T TRYHSL+V+ ESLP+CLEVTA + EIMG+RH+ VEGVQFHPESILTE Sbjct: 121 PFTATRYHSLIVEEESLPDCLEVTARSDQG-----EIMGLRHREYAVEGVQFHPESILTE 175 Query: 181 QGHELLANFL 190 G LL NFL Sbjct: 176 AGKGLLRNFL 185 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 195 Length adjustment: 20 Effective length of query: 181 Effective length of database: 175 Effective search space: 31675 Effective search space used: 31675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_012282976.1 HM1_RS08620 (aminodeoxychorismate/anthranilate synthase component II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.2984.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.2984.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.