Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_012283431.1 HM1_RS10910 LL-diaminopimelate aminotransferase
Query= BRENDA::Q8YTF2 (403 letters) >NCBI__GCF_000019165.1:WP_012283431.1 Length = 393 Score = 370 bits (950), Expect = e-107 Identities = 180/385 (46%), Positives = 258/385 (67%), Gaps = 2/385 (0%) Query: 3 FDWITPADRIQQLPPYVFARLDELKAKAREQGIDLIDLGMGNPDGATPQPVVDAAIQALQ 62 F W PA R+ L +F+R+D L+ + G+D+I+LG+G+PD V + AL Sbjct: 2 FGW-KPARRMASLSSAMFSRMDALRQEVEASGVDVINLGIGSPDRPPAPHVRQTLMDALV 60 Query: 63 DPKNHGYPPFEGTASFRRAITNWYNRRYGVVLDPDSEALPLLGSKEGLSHLAIAYVNPGD 122 +GY +G F+ A+ +WY R+GV LDP +E L L+GS++GL HL +A ++PGD Sbjct: 61 RDDAYGYALTDGLIEFKSAVADWYQERFGVALDPKTEVLSLMGSQDGLGHLGLALLDPGD 120 Query: 123 VVLVPSPAYPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNP 182 V L+P P YP + G ++A G + L L+ E D+L DL A+PE++ R+AK++ NYPSNP Sbjct: 121 VALIPDPGYPIYRAGVLLAEGFPYPLPLERERDYLPDLDAVPEDILRRAKLMILNYPSNP 180 Query: 183 TGATAPREFFEEIVAFARKYEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLS 242 ATA FF +V FAR+ I+++HD+ Y+ELA+DGY+P S L+ PGAK++G+EFH+LS Sbjct: 181 VAATAELNFFTGVVDFARRNNIIVLHDIAYSELAYDGYRPVSFLQAPGAKEVGIEFHSLS 240 Query: 243 KTYNMAGWRVGFVVGNRHVIQGLRTLKTNLDYGIFAALQTAAETALQLPDIYLHEVQQRY 302 K+YN+AG R+G VGNR V+ L LK+N+DYG+F A+Q AA AL+ P + E + Y Sbjct: 241 KSYNLAGCRLGMAVGNREVLALLANLKSNIDYGVFKAVQWAAVAALRGPQAIVEENARAY 300 Query: 303 RTRRDFLIQGLGELGWDVPKTKATMYLWVKCPVGMGST-DFALNLLQQTGVVVTPGNAFG 361 + RRD L+ GL +GW + K KA+M++W P G S+ FA LL++TGV+V PGNAFG Sbjct: 301 QRRRDVLVDGLNRIGWQMDKPKASMFVWAPVPKGFTSSFAFAEELLRETGVLVVPGNAFG 360 Query: 362 VAGEGYVRISLIADCDRLGEALDRI 386 GEGYVRI+L+ RL EA++RI Sbjct: 361 ERGEGYVRIALVVPEGRLEEAVERI 385 Lambda K H 0.321 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 393 Length adjustment: 31 Effective length of query: 372 Effective length of database: 362 Effective search space: 134664 Effective search space used: 134664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory