Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate WP_012284008.1 HM1_RS13780 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
Query= metacyc::MONOMER-13957 (96 letters) >NCBI__GCF_000019165.1:WP_012284008.1 Length = 94 Score = 79.7 bits (195), Expect = 7e-21 Identities = 36/88 (40%), Positives = 60/88 (68%) Query: 8 EVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVMREDE 67 EV++VA LARL ++E + + +T QL++I+ +A+ L ++T +V PT HV + NVMR+D Sbjct: 7 EVEYVAMLARLELSEADLERYTTQLNAILDYAQRLQGLDTKDVPPTAHVFPLHNVMRDDR 66 Query: 68 AGKGLPVEDVMKNAPDHKDGYIRVPSIL 95 + E ++ NAP+ +DG+ RVP I+ Sbjct: 67 IDPSMERERIVANAPEEEDGFFRVPRIV 94 Lambda K H 0.312 0.130 0.349 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 34 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 94 Length adjustment: 10 Effective length of query: 86 Effective length of database: 84 Effective search space: 7224 Effective search space used: 7224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 39 (19.6 bits)
Align candidate WP_012284008.1 HM1_RS13780 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.7122.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.7122.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.