Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate WP_012331535.1 M446_RS07655 FAA hydrolase family protein
Query= reanno::Smeli:SM_b21112 (281 letters) >NCBI__GCF_000019365.1:WP_012331535.1 Length = 336 Score = 171 bits (432), Expect = 3e-47 Identities = 98/221 (44%), Positives = 129/221 (58%), Gaps = 6/221 (2%) Query: 62 RLGPCVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPNDDLVLPRG-SEK 120 R P V K I +G NY HAAETG +P +P +F K +A+ + LP + + Sbjct: 116 RFAPLVTRPEKIIMMGFNYRHHAAETGTPIPKDPPLFNKYNNALNHHGGTIKLPTAVARE 175 Query: 121 TDWEVELGIVIGKTAKYVSEAEALDYVAGYCTVHDVSERAFQTERHGQWTKGKSCDTFGP 180 D+EVEL IV G+ VSEAEALD VAGY T +D S R QT Q+ GK+ D F P Sbjct: 176 FDYEVELVIVFGRECSNVSEAEALDCVAGYATGNDFSARDLQTLT-SQFMIGKTADGFAP 234 Query: 181 TGPWLVTKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRPGDIIS 240 GP+LVT D V DP +L + +VNG QD +T M++ L+S+ S+ M+++PGDI Sbjct: 235 LGPYLVTSDLVKDPNNLRLETRVNGVQRQDWNTNDMIFNCRQLISFASKMMTIKPGDIFY 294 Query: 241 TGTPPGVGMGMKPPR----YLKAGDVVELGIEGLGSQKQRV 277 TGTP GV G K PR +LK GD V +EGLG + R+ Sbjct: 295 TGTPHGVIFGEKKPRAERQWLKPGDEVACSLEGLGELRFRL 335 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 336 Length adjustment: 27 Effective length of query: 254 Effective length of database: 309 Effective search space: 78486 Effective search space used: 78486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory