Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012331692.1 M446_RS08490 ABC transporter
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000019365.1:WP_012331692.1 Length = 679 Score = 150 bits (379), Expect = 1e-40 Identities = 104/349 (29%), Positives = 178/349 (51%), Gaps = 49/349 (14%) Query: 9 IIGAVALLVLPLILQSF---GNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYA 65 I+GA ALL+L L ++ + + +Y +L LGL+IVVGY G + LG+ + Sbjct: 28 ILGA-ALLILGLAAFPHLVGSQYYIHLVTVIAIYAILILGLDIVVGYTGQVSLGHAGLFG 86 Query: 66 VGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRG 125 VGAY A++ F F +W+ + + A FG +L P L++ G Sbjct: 87 VGAYAAAVL--------FLKFKL--------GIWLGLLAGIGVTAAFGLLLAIPALRVSG 130 Query: 126 DYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGL----GQIDSVKVFGLD-----LGKRL 176 YLA+VTL FG I++IF+N + +LTNGP G+ ++ + GL G+RL Sbjct: 131 PYLAMVTLAFGTIVQIFINEM---TDLTNGPLGITLPPARVLDFSLLGLSSPWGAAGRRL 187 Query: 177 EVFGFDINSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNM 236 E +YYL +++++++ R+ S GRA+ A+R+ IA MG++ Sbjct: 188 E-----------FYYLVCACLLLTILVVNRVVRSPFGRAFEALRDSPIACDCMGVSVYRY 236 Query: 237 KLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVL 296 K+ AF + A G++GA+F + +V+P ++ +V+ + V +GG G ++GA + Sbjct: 237 KVYAFVISAGLAGLAGALFAWSERYVAPNTYGFELTVLFLLAVTMGGRKSRSGPLIGAAI 296 Query: 297 LSALP------EVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLL 339 + +P E++R +AG + A+ L A LR+ A+++ LL Sbjct: 297 VVMMPNILADIELVRMMAGGIAALAVAILAVAFLRRRENRFALLVPALL 345 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 679 Length adjustment: 34 Effective length of query: 324 Effective length of database: 645 Effective search space: 208980 Effective search space used: 208980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory