Align galactaro-1,5-lactonase (characterized)
to candidate WP_012331956.1 M446_RS09865 SMP-30/gluconolactonase/LRE family protein
Query= reanno::WCS417:GFF3393 (291 letters) >NCBI__GCF_000019365.1:WP_012331956.1 Length = 300 Score = 165 bits (418), Expect = 1e-45 Identities = 108/294 (36%), Positives = 143/294 (48%), Gaps = 14/294 (4%) Query: 2 NAELIVDARNAVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIART 61 +A ++V+A +GE P W P E LYW+D+ L R +G W P + Sbjct: 5 DAAIVVEAGAVIGEGPYWSPQERVLYWIDVKAPALFRTEPGSGATRRWPLPAEIGGYTLL 64 Query: 62 -DAGNWVAGMETGFFQLTPHNDGSLDTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVL 120 D + + G F L G+LD LAA + R N+ CD GR W G+M Sbjct: 65 PDGAGALVALRGGLFALD-FASGALDR--LAAPPFDPRTHRFNEADCDPAGRLWIGTMFE 121 Query: 121 NMGLNAAEGT---LYRYT--SGAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIW 175 + A LY YT G HA +T NG A+SPDG Y +DS +I Sbjct: 122 PLPGTEAPPRPDHLYAYTREEGLVRHAATA--LTANGFAWSPDGGRFYLADSRE--GRID 177 Query: 176 AFDYDIDTGTPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRS 235 A +D G + F + LG PDG AVDA+G YW + G +HR++PDGRLDR+ Sbjct: 178 ALAFDPARGALGPGQPFAALPAGLGVPDGGAVDAEGFYWSAIHGGGCLHRYAPDGRLDRA 237 Query: 236 LTVPVKKPTMCAFGGSRLDTLFVTSIRDDQSEQSLSGGVFALNPGVVGLPEPTF 289 + +PV+ PTM AFG L TL+VTS R D + +G V L PG G P P F Sbjct: 238 VPLPVRYPTMMAFGDEDLGTLYVTSARKDDAAPQ-AGAVLRLRPGPRGRPRPRF 290 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 300 Length adjustment: 26 Effective length of query: 265 Effective length of database: 274 Effective search space: 72610 Effective search space used: 72610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory