Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_012332138.1 M446_RS10790 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000019365.1:WP_012332138.1 Length = 281 Score = 160 bits (405), Expect = 3e-44 Identities = 99/272 (36%), Positives = 154/272 (56%), Gaps = 9/272 (3%) Query: 35 YVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKS--PTYGAFFG 92 Y ++ IG+N ILA+ + +++ GQ SLG A FM +GAY A++ K+ P A G Sbjct: 12 YQSLIHGIGVNGILALSIYVVLAV-GQLSLGQAAFMGVGAYTGALLTVKAGVPFPVAMAG 70 Query: 93 AMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIP 152 A V AL +AL+VG PTLRL G YLA+AT+G+ EI RI +N GA G+ GIP Sbjct: 71 AAAVPAL----IALVVGGPTLRLTGVYLAIATIGLGEITRIVFLNW-DYAGGALGLSGIP 125 Query: 153 NFTTWQMVYFFVVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGA 212 +Y + +A + RS IGR+ ++REDE AA +GVN + ++ A V + Sbjct: 126 EKGGVGAIYGTLAAALLALVLIARSRIGRAMEAMREDEAAAGVMGVNLPRYRMTALVVSS 185 Query: 213 ITASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQ 272 A +AG L A + P +Y F ++ +L + GG+GS ++ A +L +L +L+ Sbjct: 186 ALAGLAGCLSAHVSSFIGPNEYGFETAVTILSYALLGGIGSPVAPVLGAAILTLLPEVLR 245 Query: 273 DVASVRMIIYALALVLVMIFRPGGLLGTWELS 304 +A R+++ L +VL ++F P G+L W ++ Sbjct: 246 PLADFRLMVNGLIIVLAVLFMPRGIL-PWRIA 276 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 281 Length adjustment: 27 Effective length of query: 291 Effective length of database: 254 Effective search space: 73914 Effective search space used: 73914 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory