Align fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) (characterized)
to candidate WP_012332560.1 M446_RS12995 fumarylacetoacetate hydrolase
Query= reanno::psRCH2:GFF3447 (327 letters) >NCBI__GCF_000019365.1:WP_012332560.1 Length = 330 Score = 244 bits (624), Expect = 2e-69 Identities = 150/340 (44%), Positives = 201/340 (59%), Gaps = 29/340 (8%) Query: 1 MKLATLNQGRDGVLVVVSRDLAQAVKVPQIAATLQAALDDWNYCKPKLEAVYQRLNDGLE 60 MKLA+L GRDG LVVVSRDL +A + TLQ ALD+W+ P LEA+ ++L G Sbjct: 1 MKLASLAHGRDGRLVVVSRDLTRATDAFIVVPTLQQALDEWDRHGPALEALAEQLEHG-S 59 Query: 61 EGAFAFDQTACHSPLPRAYHWADGSAYVNHVELVRKARGAEMPESFWHDPLMYQGGADAF 120 +F F + AC +PLPRA+ +A+ HV L+R+A GAE P PL + +D F Sbjct: 60 VPSFRFHEHACAAPLPRAFARRHAAAWPGHVRLLRQAEGAEAPSDSG-TPLRH-AASDGF 117 Query: 121 IPPHSPIRLADEAWGIDLEGELAVITDDVPMGATPAEAASHIQLLMLVNDVSLRNLIP-- 178 + P + + AD A +D+ LAVIT DV G PA+AA ++L+ LV +V R+ + Sbjct: 118 LAPRATLP-ADPAASLDVSAGLAVITGDVAQGTAPAQAAGAVRLVTLVTEVIRRDRLKPD 176 Query: 179 -----GELAKGFGFYQSKPSSSFSPVAVTPDELGETWRDGKVHRPLVSHINGELFGQPDA 233 G LA GF ++S PVAVTPDELG W+DG V RPL NG L G+P+A Sbjct: 177 GLDLDGPLAAGF-------AASLGPVAVTPDELGPDWQDGMVQRPLCVTRNGALLGRPEA 229 Query: 234 GTDMTFNFPTLVAHAARTRPLGAGTIIGSGTVSN-----------YDRSAGSSCLAEKRM 282 G+D+ F L+A AAR RPLGAGTI+ +G VSN + AG + LAE R Sbjct: 230 GSDLGSGFGELIAEAARLRPLGAGTIVSAGPVSNRGIDGGPGRSVAEGGAGFASLAEARA 289 Query: 283 LEVVEHGEAKTPFLKFGDRVRIEMFDAAGQSIFGAIDQQV 322 E+V G A+ P+L GDR+R+E+ D G S+FGAI+ +V Sbjct: 290 AEIVASGWARLPYLAPGDRLRVEVKDRGGHSVFGAIEHEV 329 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 330 Length adjustment: 28 Effective length of query: 299 Effective length of database: 302 Effective search space: 90298 Effective search space used: 90298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory