Align 2-keto-3-deoxy-galactonokinase (characterized, see rationale)
to candidate WP_012334349.1 M446_RS22150 2-keto-3-deoxy-galactonokinase
Query= uniprot:B2SYR9 (350 letters) >NCBI__GCF_000019365.1:WP_012334349.1 Length = 295 Score = 195 bits (496), Expect = 1e-54 Identities = 132/309 (42%), Positives = 170/309 (55%), Gaps = 27/309 (8%) Query: 28 LIALDWGTTSLRAYLYDASGNVLATRASTAGIMNLPRSAEQGGFDAAFDDTCGAWLAHAP 87 +IA+DWGT+S RAY +G+V R + GIM + G F AA D G W+A A Sbjct: 1 MIAIDWGTSSARAYRLGPTGSVTERRETGRGIMQVAG----GDFPAALRDLAGDWIA-AG 55 Query: 88 AAPVIAAGMVGSAQGWLEAPYVDTPASADALVAGIVRVKAACGVTLHIVPGVLQRGE--L 145 V+ +GM+GS QGW E PY PA L AG+ V G + IVPG+ R + Sbjct: 56 EGRVLLSGMIGSRQGWREVPYRACPAGLADLAAGVEAVPFP-GAAVRIVPGLSARDASGI 114 Query: 146 PNVMRGEETQIFGALGEETNTADSGKRSLIGLPGTHAKWAVVQADRIERFHTFMTGEVFA 205 P VMRGEE Q+FGAL D + +L+ LPG+H+KW V+ RI F T +TGE FA Sbjct: 115 PEVMRGEEVQVFGAL-------DGREEALLCLPGSHSKWVRVRGGRIAGFVTSLTGEAFA 167 Query: 206 ALREHTILGRTMLTPDSPDTSAFLHGVNIAREKGQAGVLATVFSSRTLGLTGQLSREQQP 265 ALREHTILGR M P AF GV A E G G+L +F +RTLGL G+L + Sbjct: 168 ALREHTILGRMMRGAPEPG-GAFDAGVARAAEPG--GLLHHLFGTRTLGLFGRLPEAEAA 224 Query: 266 DYLSGLLIGHELAGLDAVLAQQQSALAGQSLRLIGNEALCERYRLALAQFGCTQAELVKH 325 YLSGLLIGH++ + + AG+++ LIG+ L Y A+A G T Sbjct: 225 SYLSGLLIGHDV---------RANLPAGEAVDLIGSGPLMALYGRAIAACGGTARAGDPD 275 Query: 326 ATERGLWRV 334 A RGL R+ Sbjct: 276 AALRGLARI 284 Lambda K H 0.318 0.131 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 295 Length adjustment: 28 Effective length of query: 322 Effective length of database: 267 Effective search space: 85974 Effective search space used: 85974 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory